EBI Dbfetch

ID   Z99281; SV 1; linear; genomic DNA; STD; INV; 313573 BP.
XX
AC   Z99281;
XX
DT   17-SEP-1997 (Rel. 52, Created)
DT   30-NOV-2009 (Rel. 103, Last updated, Version 81)
XX
DE   Caenorhabditis elegans YAC Y57G11C
XX
KW   HTG.
XX
OS   Caenorhabditis elegans
OC   Eukaryota; Metazoa; Nematoda; Chromadorea; Rhabditida; Rhabditoidea;
OC   Rhabditidae; Peloderinae; Caenorhabditis.
XX
RN   [1]
RP   1-313573
RX   DOI; 10.1126/science.282.5396.2012
RX   PUBMED; 9851916.
RG   WormBase Consortium
RA   ;
RT   "Genome sequence of the nematode C. elegans: a platform for investigating
RT   biology";
RL   Science 282(5396):2012-2018(1998).
XX
RN   [2]
RP   1-313573
RA   McMurray A.A.;
RT   ;
RL   Submitted (17-SEP-1997) to the EMBL/GenBank/DDBJ databases.
RL   Nematode Sequencing Project, Sanger Institute, Hinxton, Cambridge CB10 1SA,
RL   England and Department of Genetics, Washington University, St. Louis, MO
RL   63110, USA. E-mail: worm@sanger.ac.uk
XX
DR   EMBL-CON; BX284604.
DR   RFAM; RF00005; tRNA.
XX
CC   Coding sequences below are predicted from computer analysis, using
CC   predictions from Genefinder (P. Green, U. Washington), and other
CC   available information.
CC   
CC   Current sequence finishing criteria for the C. elegans genome
CC   sequencing consortium are that all bases are either sequenced
CC   unambiguously on both strands, or on a single strand with both a
CC   dye primer and dye terminator reaction, from distinct subclones.
CC   Exceptions are indicated by an explicit note.
CC   
CC   IMPORTANT:  This sequence is NOT necessarily the entire insert of
CC   the specified clone.  It may be shorter because we only sequence
CC   overlapping sections once, or longer because we arrange for a
CC   small overlap between neighbouring submissions.
CC   
CC   For a graphical representation of this sequence and its analysis
CC   see:- http://www.wormbase.org/perl/ace/elegans/seq/sequence?
CC   name=Y57G11C;class=Sequence
CC   
CC   IMPORTANT: This sequence is not the entire insert of clone Y57G11C.
CC   It may be shorter because we only sequence overlapping
CC   sections once, or longer because we arrange for a small
CC   overlap between neighbouring submissions.
CC   The true left end of clone Y41E3 is at 254309 in this sequence.
CC   The true left end of clone F52D11 is at 286315 in this sequence.
CC   The true right end of clone Y57G11 is at 313573 in this sequence.
CC   The start of this sequence (1..104) overlaps with the end of
CC   sequence Z83317.
CC   The end of this sequence (313470..313573) overlaps with the start
CC   of sequence Z95559.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..313573
FT                   /organism="Caenorhabditis elegans"
FT                   /chromosome="IV"
FT                   /strain="Bristol N2"
FT                   /mol_type="genomic DNA"
FT                   /clone="Y57G11C"
FT                   /db_xref="taxon:6239"
FT   ncRNA           complement(127576..127762)
FT                   /locus_tag="Y57G11C.35"
FT                   /standard_name="Y57G11C.35"
FT                   /product="Hypothetical RNA transcript Y57G11C.35"
FT                   /note="U2-9-RNA"
FT                   /note="C. elegans small nuclear RNA U2-9"
FT                   /ncRNA_class="snRNA"
FT   tRNA            complement(251750..251821)
FT                   /locus_tag="Y57G11C.t1"
FT                   /standard_name="Y57G11C.t1"
FT                   /product="Hypothetical RNA transcript Y57G11C.t1"
FT                   /note="preliminary prediction"
FT                   /note="C. elegans predicted tRNA"
FT   ncRNA           join(210300..210451,210936..211197,213552..213879,
FT                   215362..215669,216178..216332)
FT                   /locus_tag="Y57G11C.22b"
FT                   /standard_name="Y57G11C.22b"
FT                   /product="Hypothetical RNA transcript Y57G11C.22b"
FT                   /note="C. elegans probable non-coding RNA"
FT                   /ncRNA_class="other"
FT   ncRNA           226715..226792
FT                   /locus_tag="Y57G11C.55"
FT                   /standard_name="Y57G11C.55"
FT                   /product="Hypothetical RNA transcript Y57G11C.55"
FT                   /note="CeN25-4-RNA"
FT                   /note="C. elegans small nuclear RNA CeN25-4 smy-11"
FT                   /ncRNA_class="snRNA"
FT   ncRNA           227472..227551
FT                   /locus_tag="Y57G11C.53"
FT                   /standard_name="Y57G11C.53"
FT                   /product="Hypothetical RNA transcript Y57G11C.53"
FT                   /note="snlRNA"
FT                   /note="C. elegans non-protein coding RNA smy-12"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(88662..88682)
FT                   /locus_tag="Y57G11C.58"
FT                   /standard_name="Y57G11C.58"
FT                   /product="Hypothetical RNA transcript Y57G11C.58"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046973 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           241127..241147
FT                   /locus_tag="Y57G11C.59"
FT                   /standard_name="Y57G11C.59"
FT                   /product="Hypothetical RNA transcript Y57G11C.59"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047962 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(256109..256129)
FT                   /locus_tag="Y57G11C.60"
FT                   /standard_name="Y57G11C.60"
FT                   /product="Hypothetical RNA transcript Y57G11C.60"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045955 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(2354..2374)
FT                   /locus_tag="Y57G11C.61"
FT                   /standard_name="Y57G11C.61"
FT                   /product="Hypothetical RNA transcript Y57G11C.61"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047858 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           80411..80431
FT                   /locus_tag="Y57G11C.62"
FT                   /standard_name="Y57G11C.62"
FT                   /product="Hypothetical RNA transcript Y57G11C.62"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046252 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           280067..280087
FT                   /locus_tag="Y57G11C.63"
FT                   /standard_name="Y57G11C.63"
FT                   /product="Hypothetical RNA transcript Y57G11C.63"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049948 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           127166..127186
FT                   /locus_tag="Y57G11C.64"
FT                   /standard_name="Y57G11C.64"
FT                   /product="Hypothetical RNA transcript Y57G11C.64"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045809 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           53287..53307
FT                   /locus_tag="Y57G11C.65"
FT                   /standard_name="Y57G11C.65"
FT                   /product="Hypothetical RNA transcript Y57G11C.65"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049548 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           105784..105804
FT                   /locus_tag="Y57G11C.66"
FT                   /standard_name="Y57G11C.66"
FT                   /product="Hypothetical RNA transcript Y57G11C.66"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045033 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(13321..13341)
FT                   /locus_tag="Y57G11C.67"
FT                   /standard_name="Y57G11C.67"
FT                   /product="Hypothetical RNA transcript Y57G11C.67"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045246 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(42838..42858)
FT                   /locus_tag="Y57G11C.68"
FT                   /standard_name="Y57G11C.68"
FT                   /product="Hypothetical RNA transcript Y57G11C.68"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049248 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(119865..119885)
FT                   /locus_tag="Y57G11C.69"
FT                   /standard_name="Y57G11C.69"
FT                   /product="Hypothetical RNA transcript Y57G11C.69"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048973 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47589..47609)
FT                   /locus_tag="Y57G11C.70"
FT                   /standard_name="Y57G11C.70"
FT                   /product="Hypothetical RNA transcript Y57G11C.70"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046159 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           174082..174102
FT                   /locus_tag="Y57G11C.71"
FT                   /standard_name="Y57G11C.71"
FT                   /product="Hypothetical RNA transcript Y57G11C.71"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048378 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           269884..269904
FT                   /locus_tag="Y57G11C.72"
FT                   /standard_name="Y57G11C.72"
FT                   /product="Hypothetical RNA transcript Y57G11C.72"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044841 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           303984..304004
FT                   /locus_tag="Y57G11C.73"
FT                   /standard_name="Y57G11C.73"
FT                   /product="Hypothetical RNA transcript Y57G11C.73"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046408 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193591..193611
FT                   /locus_tag="Y57G11C.74"
FT                   /standard_name="Y57G11C.74"
FT                   /product="Hypothetical RNA transcript Y57G11C.74"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048646 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77488..77508)
FT                   /locus_tag="Y57G11C.75"
FT                   /standard_name="Y57G11C.75"
FT                   /product="Hypothetical RNA transcript Y57G11C.75"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045744 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           112647..112667
FT                   /locus_tag="Y57G11C.76"
FT                   /standard_name="Y57G11C.76"
FT                   /product="Hypothetical RNA transcript Y57G11C.76"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046355 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           278262..278282
FT                   /locus_tag="Y57G11C.77"
FT                   /standard_name="Y57G11C.77"
FT                   /product="Hypothetical RNA transcript Y57G11C.77"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046727 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           305268..305288
FT                   /locus_tag="Y57G11C.78"
FT                   /standard_name="Y57G11C.78"
FT                   /product="Hypothetical RNA transcript Y57G11C.78"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049103 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           311802..311822
FT                   /locus_tag="Y57G11C.79"
FT                   /standard_name="Y57G11C.79"
FT                   /product="Hypothetical RNA transcript Y57G11C.79"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047389 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(35247..35267)
FT                   /locus_tag="Y57G11C.80"
FT                   /standard_name="Y57G11C.80"
FT                   /product="Hypothetical RNA transcript Y57G11C.80"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046297 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           108022..108042
FT                   /locus_tag="Y57G11C.81"
FT                   /standard_name="Y57G11C.81"
FT                   /product="Hypothetical RNA transcript Y57G11C.81"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046534 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(309381..309401)
FT                   /locus_tag="Y57G11C.82"
FT                   /standard_name="Y57G11C.82"
FT                   /product="Hypothetical RNA transcript Y57G11C.82"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049196 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(3948..3968)
FT                   /locus_tag="Y57G11C.83"
FT                   /standard_name="Y57G11C.83"
FT                   /product="Hypothetical RNA transcript Y57G11C.83"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046958 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233310..233330
FT                   /locus_tag="Y57G11C.84"
FT                   /standard_name="Y57G11C.84"
FT                   /product="Hypothetical RNA transcript Y57G11C.84"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045702 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           7825..7845
FT                   /locus_tag="Y57G11C.85"
FT                   /standard_name="Y57G11C.85"
FT                   /product="Hypothetical RNA transcript Y57G11C.85"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045954 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(2112..2132)
FT                   /locus_tag="Y57G11C.86"
FT                   /standard_name="Y57G11C.86"
FT                   /product="Hypothetical RNA transcript Y57G11C.86"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046548 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(240105..240125)
FT                   /locus_tag="Y57G11C.87"
FT                   /standard_name="Y57G11C.87"
FT                   /product="Hypothetical RNA transcript Y57G11C.87"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044952 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           240972..240992
FT                   /locus_tag="Y57G11C.88"
FT                   /standard_name="Y57G11C.88"
FT                   /product="Hypothetical RNA transcript Y57G11C.88"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045219 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(112342..112362)
FT                   /locus_tag="Y57G11C.89"
FT                   /standard_name="Y57G11C.89"
FT                   /product="Hypothetical RNA transcript Y57G11C.89"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046786 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           114567..114587
FT                   /locus_tag="Y57G11C.90"
FT                   /standard_name="Y57G11C.90"
FT                   /product="Hypothetical RNA transcript Y57G11C.90"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045312 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           114564..114584
FT                   /locus_tag="Y57G11C.91"
FT                   /standard_name="Y57G11C.91"
FT                   /product="Hypothetical RNA transcript Y57G11C.91"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046776 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193016..193036
FT                   /locus_tag="Y57G11C.92"
FT                   /standard_name="Y57G11C.92"
FT                   /product="Hypothetical RNA transcript Y57G11C.92"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048578 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           294778..294798
FT                   /locus_tag="Y57G11C.93"
FT                   /standard_name="Y57G11C.93"
FT                   /product="Hypothetical RNA transcript Y57G11C.93"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048772 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(80910..80930)
FT                   /locus_tag="Y57G11C.94"
FT                   /standard_name="Y57G11C.94"
FT                   /product="Hypothetical RNA transcript Y57G11C.94"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044634 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           286998..287018
FT                   /locus_tag="Y57G11C.95"
FT                   /standard_name="Y57G11C.95"
FT                   /product="Hypothetical RNA transcript Y57G11C.95"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045678 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(166400..166420)
FT                   /locus_tag="Y57G11C.96"
FT                   /standard_name="Y57G11C.96"
FT                   /product="Hypothetical RNA transcript Y57G11C.96"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047723 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(262257..262277)
FT                   /locus_tag="Y57G11C.97"
FT                   /standard_name="Y57G11C.97"
FT                   /product="Hypothetical RNA transcript Y57G11C.97"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048094 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(308455..308475)
FT                   /locus_tag="Y57G11C.98"
FT                   /standard_name="Y57G11C.98"
FT                   /product="Hypothetical RNA transcript Y57G11C.98"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047384 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(56258..56278)
FT                   /locus_tag="Y57G11C.99"
FT                   /standard_name="Y57G11C.99"
FT                   /product="Hypothetical RNA transcript Y57G11C.99"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046587 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           175390..175410
FT                   /locus_tag="Y57G11C.100"
FT                   /standard_name="Y57G11C.100"
FT                   /product="Hypothetical RNA transcript Y57G11C.100"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048997 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           173745..173765
FT                   /locus_tag="Y57G11C.101"
FT                   /standard_name="Y57G11C.101"
FT                   /product="Hypothetical RNA transcript Y57G11C.101"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046817 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(74113..74133)
FT                   /locus_tag="Y57G11C.102"
FT                   /standard_name="Y57G11C.102"
FT                   /product="Hypothetical RNA transcript Y57G11C.102"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049233 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           45546..45566
FT                   /locus_tag="Y57G11C.103"
FT                   /standard_name="Y57G11C.103"
FT                   /product="Hypothetical RNA transcript Y57G11C.103"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045692 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(273296..273316)
FT                   /locus_tag="Y57G11C.104"
FT                   /standard_name="Y57G11C.104"
FT                   /product="Hypothetical RNA transcript Y57G11C.104"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048700 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(36895..36915)
FT                   /locus_tag="Y57G11C.105"
FT                   /standard_name="Y57G11C.105"
FT                   /product="Hypothetical RNA transcript Y57G11C.105"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049480 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(253533..253553)
FT                   /locus_tag="Y57G11C.106"
FT                   /standard_name="Y57G11C.106"
FT                   /product="Hypothetical RNA transcript Y57G11C.106"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049200 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           234277..234297
FT                   /locus_tag="Y57G11C.107"
FT                   /standard_name="Y57G11C.107"
FT                   /product="Hypothetical RNA transcript Y57G11C.107"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047454 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           244291..244311
FT                   /locus_tag="Y57G11C.108"
FT                   /standard_name="Y57G11C.108"
FT                   /product="Hypothetical RNA transcript Y57G11C.108"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046444 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           32369..32389
FT                   /locus_tag="Y57G11C.109"
FT                   /standard_name="Y57G11C.109"
FT                   /product="Hypothetical RNA transcript Y57G11C.109"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044947 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           109824..109844
FT                   /locus_tag="Y57G11C.110"
FT                   /standard_name="Y57G11C.110"
FT                   /product="Hypothetical RNA transcript Y57G11C.110"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049437 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           257899..257919
FT                   /locus_tag="Y57G11C.111"
FT                   /standard_name="Y57G11C.111"
FT                   /product="Hypothetical RNA transcript Y57G11C.111"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049149 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           104588..104608
FT                   /locus_tag="Y57G11C.112"
FT                   /standard_name="Y57G11C.112"
FT                   /product="Hypothetical RNA transcript Y57G11C.112"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048474 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(97855..97875)
FT                   /locus_tag="Y57G11C.113"
FT                   /standard_name="Y57G11C.113"
FT                   /product="Hypothetical RNA transcript Y57G11C.113"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044726 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(271476..271496)
FT                   /locus_tag="Y57G11C.114"
FT                   /standard_name="Y57G11C.114"
FT                   /product="Hypothetical RNA transcript Y57G11C.114"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045756 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30927..30947
FT                   /locus_tag="Y57G11C.115"
FT                   /standard_name="Y57G11C.115"
FT                   /product="Hypothetical RNA transcript Y57G11C.115"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044757 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(67689..67709)
FT                   /locus_tag="Y57G11C.116"
FT                   /standard_name="Y57G11C.116"
FT                   /product="Hypothetical RNA transcript Y57G11C.116"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048325 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           90973..90993
FT                   /locus_tag="Y57G11C.117"
FT                   /standard_name="Y57G11C.117"
FT                   /product="Hypothetical RNA transcript Y57G11C.117"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045861 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           43813..43833
FT                   /locus_tag="Y57G11C.118"
FT                   /standard_name="Y57G11C.118"
FT                   /product="Hypothetical RNA transcript Y57G11C.118"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045342 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           194998..195018
FT                   /locus_tag="Y57G11C.119"
FT                   /standard_name="Y57G11C.119"
FT                   /product="Hypothetical RNA transcript Y57G11C.119"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048778 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9471..9491)
FT                   /locus_tag="Y57G11C.120"
FT                   /standard_name="Y57G11C.120"
FT                   /product="Hypothetical RNA transcript Y57G11C.120"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045939 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(174267..174287)
FT                   /locus_tag="Y57G11C.121"
FT                   /standard_name="Y57G11C.121"
FT                   /product="Hypothetical RNA transcript Y57G11C.121"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047237 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           254160..254180
FT                   /locus_tag="Y57G11C.122"
FT                   /standard_name="Y57G11C.122"
FT                   /product="Hypothetical RNA transcript Y57G11C.122"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047039 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(94360..94380)
FT                   /locus_tag="Y57G11C.123"
FT                   /standard_name="Y57G11C.123"
FT                   /product="Hypothetical RNA transcript Y57G11C.123"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046349 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(219334..219354)
FT                   /locus_tag="Y57G11C.124"
FT                   /standard_name="Y57G11C.124"
FT                   /product="Hypothetical RNA transcript Y57G11C.124"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046660 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(46642..46662)
FT                   /locus_tag="Y57G11C.125"
FT                   /standard_name="Y57G11C.125"
FT                   /product="Hypothetical RNA transcript Y57G11C.125"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046182 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193389..193409
FT                   /locus_tag="Y57G11C.126"
FT                   /standard_name="Y57G11C.126"
FT                   /product="Hypothetical RNA transcript Y57G11C.126"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049981 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193472..193492
FT                   /locus_tag="Y57G11C.127"
FT                   /standard_name="Y57G11C.127"
FT                   /product="Hypothetical RNA transcript Y57G11C.127"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045502 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(224939..224959)
FT                   /locus_tag="Y57G11C.128"
FT                   /standard_name="Y57G11C.128"
FT                   /product="Hypothetical RNA transcript Y57G11C.128"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048218 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           108442..108462
FT                   /locus_tag="Y57G11C.129"
FT                   /standard_name="Y57G11C.129"
FT                   /product="Hypothetical RNA transcript Y57G11C.129"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046612 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           182189..182209
FT                   /locus_tag="Y57G11C.130"
FT                   /standard_name="Y57G11C.130"
FT                   /product="Hypothetical RNA transcript Y57G11C.130"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045769 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           180524..180544
FT                   /locus_tag="Y57G11C.131"
FT                   /standard_name="Y57G11C.131"
FT                   /product="Hypothetical RNA transcript Y57G11C.131"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045480 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(21239..21259)
FT                   /locus_tag="Y57G11C.132"
FT                   /standard_name="Y57G11C.132"
FT                   /product="Hypothetical RNA transcript Y57G11C.132"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049581 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           54835..54855
FT                   /locus_tag="Y57G11C.133"
FT                   /standard_name="Y57G11C.133"
FT                   /product="Hypothetical RNA transcript Y57G11C.133"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046055 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           75810..75830
FT                   /locus_tag="Y57G11C.134"
FT                   /standard_name="Y57G11C.134"
FT                   /product="Hypothetical RNA transcript Y57G11C.134"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047816 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(110908..110928)
FT                   /locus_tag="Y57G11C.135"
FT                   /standard_name="Y57G11C.135"
FT                   /product="Hypothetical RNA transcript Y57G11C.135"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045046 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           215282..215302
FT                   /locus_tag="Y57G11C.136"
FT                   /standard_name="Y57G11C.136"
FT                   /product="Hypothetical RNA transcript Y57G11C.136"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049730 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           112814..112834
FT                   /locus_tag="Y57G11C.137"
FT                   /standard_name="Y57G11C.137"
FT                   /product="Hypothetical RNA transcript Y57G11C.137"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046743 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           6765..6785
FT                   /locus_tag="Y57G11C.138"
FT                   /standard_name="Y57G11C.138"
FT                   /product="Hypothetical RNA transcript Y57G11C.138"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049162 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(65395..65415)
FT                   /locus_tag="Y57G11C.139"
FT                   /standard_name="Y57G11C.139"
FT                   /product="Hypothetical RNA transcript Y57G11C.139"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048470 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           802..822
FT                   /locus_tag="Y57G11C.140"
FT                   /standard_name="Y57G11C.140"
FT                   /product="Hypothetical RNA transcript Y57G11C.140"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048113 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           168211..168231
FT                   /locus_tag="Y57G11C.141"
FT                   /standard_name="Y57G11C.141"
FT                   /product="Hypothetical RNA transcript Y57G11C.141"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047635 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(79534..79554)
FT                   /locus_tag="Y57G11C.142"
FT                   /standard_name="Y57G11C.142"
FT                   /product="Hypothetical RNA transcript Y57G11C.142"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049511 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           284363..284383
FT                   /locus_tag="Y57G11C.143"
FT                   /standard_name="Y57G11C.143"
FT                   /product="Hypothetical RNA transcript Y57G11C.143"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044860 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(84293..84313)
FT                   /locus_tag="Y57G11C.144"
FT                   /standard_name="Y57G11C.144"
FT                   /product="Hypothetical RNA transcript Y57G11C.144"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047617 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(237239..237259)
FT                   /locus_tag="Y57G11C.145"
FT                   /standard_name="Y57G11C.145"
FT                   /product="Hypothetical RNA transcript Y57G11C.145"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046358 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           79013..79033
FT                   /locus_tag="Y57G11C.146"
FT                   /standard_name="Y57G11C.146"
FT                   /product="Hypothetical RNA transcript Y57G11C.146"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045201 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(53142..53162)
FT                   /locus_tag="Y57G11C.147"
FT                   /standard_name="Y57G11C.147"
FT                   /product="Hypothetical RNA transcript Y57G11C.147"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049085 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(211491..211511)
FT                   /locus_tag="Y57G11C.148"
FT                   /standard_name="Y57G11C.148"
FT                   /product="Hypothetical RNA transcript Y57G11C.148"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047904 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247916..247936
FT                   /locus_tag="Y57G11C.149"
FT                   /standard_name="Y57G11C.149"
FT                   /product="Hypothetical RNA transcript Y57G11C.149"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048764 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(70243..70263)
FT                   /locus_tag="Y57G11C.150"
FT                   /standard_name="Y57G11C.150"
FT                   /product="Hypothetical RNA transcript Y57G11C.150"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048188 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           48337..48357
FT                   /locus_tag="Y57G11C.151"
FT                   /standard_name="Y57G11C.151"
FT                   /product="Hypothetical RNA transcript Y57G11C.151"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044733 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214921..214941)
FT                   /locus_tag="Y57G11C.152"
FT                   /standard_name="Y57G11C.152"
FT                   /product="Hypothetical RNA transcript Y57G11C.152"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047923 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           229799..229819
FT                   /locus_tag="Y57G11C.153"
FT                   /standard_name="Y57G11C.153"
FT                   /product="Hypothetical RNA transcript Y57G11C.153"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048625 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           290775..290795
FT                   /locus_tag="Y57G11C.154"
FT                   /standard_name="Y57G11C.154"
FT                   /product="Hypothetical RNA transcript Y57G11C.154"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047092 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(179622..179642)
FT                   /locus_tag="Y57G11C.155"
FT                   /standard_name="Y57G11C.155"
FT                   /product="Hypothetical RNA transcript Y57G11C.155"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045860 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(231179..231199)
FT                   /locus_tag="Y57G11C.156"
FT                   /standard_name="Y57G11C.156"
FT                   /product="Hypothetical RNA transcript Y57G11C.156"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046086 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(271271..271291)
FT                   /locus_tag="Y57G11C.157"
FT                   /standard_name="Y57G11C.157"
FT                   /product="Hypothetical RNA transcript Y57G11C.157"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049204 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58713..58733
FT                   /locus_tag="Y57G11C.158"
FT                   /standard_name="Y57G11C.158"
FT                   /product="Hypothetical RNA transcript Y57G11C.158"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045935 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(93088..93108)
FT                   /locus_tag="Y57G11C.159"
FT                   /standard_name="Y57G11C.159"
FT                   /product="Hypothetical RNA transcript Y57G11C.159"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045469 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(67115..67135)
FT                   /locus_tag="Y57G11C.160"
FT                   /standard_name="Y57G11C.160"
FT                   /product="Hypothetical RNA transcript Y57G11C.160"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046183 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           100491..100511
FT                   /locus_tag="Y57G11C.161"
FT                   /standard_name="Y57G11C.161"
FT                   /product="Hypothetical RNA transcript Y57G11C.161"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047613 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(249153..249173)
FT                   /locus_tag="Y57G11C.162"
FT                   /standard_name="Y57G11C.162"
FT                   /product="Hypothetical RNA transcript Y57G11C.162"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045004 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           219096..219116
FT                   /locus_tag="Y57G11C.163"
FT                   /standard_name="Y57G11C.163"
FT                   /product="Hypothetical RNA transcript Y57G11C.163"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044585 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(25379..25399)
FT                   /locus_tag="Y57G11C.164"
FT                   /standard_name="Y57G11C.164"
FT                   /product="Hypothetical RNA transcript Y57G11C.164"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046502 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           176457..176477
FT                   /locus_tag="Y57G11C.165"
FT                   /standard_name="Y57G11C.165"
FT                   /product="Hypothetical RNA transcript Y57G11C.165"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044658 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(276730..276750)
FT                   /locus_tag="Y57G11C.166"
FT                   /standard_name="Y57G11C.166"
FT                   /product="Hypothetical RNA transcript Y57G11C.166"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048853 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250688..250708)
FT                   /locus_tag="Y57G11C.167"
FT                   /standard_name="Y57G11C.167"
FT                   /product="Hypothetical RNA transcript Y57G11C.167"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047424 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(95287..95307)
FT                   /locus_tag="Y57G11C.168"
FT                   /standard_name="Y57G11C.168"
FT                   /product="Hypothetical RNA transcript Y57G11C.168"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048388 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(72477..72497)
FT                   /locus_tag="Y57G11C.169"
FT                   /standard_name="Y57G11C.169"
FT                   /product="Hypothetical RNA transcript Y57G11C.169"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047772 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(57839..57859)
FT                   /locus_tag="Y57G11C.170"
FT                   /standard_name="Y57G11C.170"
FT                   /product="Hypothetical RNA transcript Y57G11C.170"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047164 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(69514..69534)
FT                   /locus_tag="Y57G11C.171"
FT                   /standard_name="Y57G11C.171"
FT                   /product="Hypothetical RNA transcript Y57G11C.171"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045422 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(267631..267651)
FT                   /locus_tag="Y57G11C.172"
FT                   /standard_name="Y57G11C.172"
FT                   /product="Hypothetical RNA transcript Y57G11C.172"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045210 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(46362..46382)
FT                   /locus_tag="Y57G11C.173"
FT                   /standard_name="Y57G11C.173"
FT                   /product="Hypothetical RNA transcript Y57G11C.173"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046410 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77168..77188)
FT                   /locus_tag="Y57G11C.174"
FT                   /standard_name="Y57G11C.174"
FT                   /product="Hypothetical RNA transcript Y57G11C.174"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046047 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           229504..229524
FT                   /locus_tag="Y57G11C.175"
FT                   /standard_name="Y57G11C.175"
FT                   /product="Hypothetical RNA transcript Y57G11C.175"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048936 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           293763..293783
FT                   /locus_tag="Y57G11C.176"
FT                   /standard_name="Y57G11C.176"
FT                   /product="Hypothetical RNA transcript Y57G11C.176"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047710 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           262908..262928
FT                   /locus_tag="Y57G11C.177"
FT                   /standard_name="Y57G11C.177"
FT                   /product="Hypothetical RNA transcript Y57G11C.177"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047065 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           192617..192637
FT                   /locus_tag="Y57G11C.178"
FT                   /standard_name="Y57G11C.178"
FT                   /product="Hypothetical RNA transcript Y57G11C.178"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045673 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(289959..289979)
FT                   /locus_tag="Y57G11C.179"
FT                   /standard_name="Y57G11C.179"
FT                   /product="Hypothetical RNA transcript Y57G11C.179"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047314 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(106631..106651)
FT                   /locus_tag="Y57G11C.180"
FT                   /standard_name="Y57G11C.180"
FT                   /product="Hypothetical RNA transcript Y57G11C.180"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048121 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(226311..226331)
FT                   /locus_tag="Y57G11C.181"
FT                   /standard_name="Y57G11C.181"
FT                   /product="Hypothetical RNA transcript Y57G11C.181"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045577 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(83776..83796)
FT                   /locus_tag="Y57G11C.182"
FT                   /standard_name="Y57G11C.182"
FT                   /product="Hypothetical RNA transcript Y57G11C.182"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047146 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120690..120710
FT                   /locus_tag="Y57G11C.183"
FT                   /standard_name="Y57G11C.183"
FT                   /product="Hypothetical RNA transcript Y57G11C.183"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044868 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           249790..249810
FT                   /locus_tag="Y57G11C.184"
FT                   /standard_name="Y57G11C.184"
FT                   /product="Hypothetical RNA transcript Y57G11C.184"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048574 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(49308..49328)
FT                   /locus_tag="Y57G11C.185"
FT                   /standard_name="Y57G11C.185"
FT                   /product="Hypothetical RNA transcript Y57G11C.185"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047066 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           245733..245753
FT                   /locus_tag="Y57G11C.186"
FT                   /standard_name="Y57G11C.186"
FT                   /product="Hypothetical RNA transcript Y57G11C.186"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047833 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(34606..34626)
FT                   /locus_tag="Y57G11C.187"
FT                   /standard_name="Y57G11C.187"
FT                   /product="Hypothetical RNA transcript Y57G11C.187"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049606 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           268889..268909
FT                   /locus_tag="Y57G11C.188"
FT                   /standard_name="Y57G11C.188"
FT                   /product="Hypothetical RNA transcript Y57G11C.188"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046061 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(37949..37969)
FT                   /locus_tag="Y57G11C.189"
FT                   /standard_name="Y57G11C.189"
FT                   /product="Hypothetical RNA transcript Y57G11C.189"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045423 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           266933..266953
FT                   /locus_tag="Y57G11C.190"
FT                   /standard_name="Y57G11C.190"
FT                   /product="Hypothetical RNA transcript Y57G11C.190"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046941 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           267386..267406
FT                   /locus_tag="Y57G11C.191"
FT                   /standard_name="Y57G11C.191"
FT                   /product="Hypothetical RNA transcript Y57G11C.191"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045979 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250944..250964)
FT                   /locus_tag="Y57G11C.192"
FT                   /standard_name="Y57G11C.192"
FT                   /product="Hypothetical RNA transcript Y57G11C.192"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049666 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           111624..111644
FT                   /locus_tag="Y57G11C.193"
FT                   /standard_name="Y57G11C.193"
FT                   /product="Hypothetical RNA transcript Y57G11C.193"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048073 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           169136..169156
FT                   /locus_tag="Y57G11C.194"
FT                   /standard_name="Y57G11C.194"
FT                   /product="Hypothetical RNA transcript Y57G11C.194"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044940 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           212875..212895
FT                   /locus_tag="Y57G11C.195"
FT                   /standard_name="Y57G11C.195"
FT                   /product="Hypothetical RNA transcript Y57G11C.195"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049049 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(5193..5213)
FT                   /locus_tag="Y57G11C.196"
FT                   /standard_name="Y57G11C.196"
FT                   /product="Hypothetical RNA transcript Y57G11C.196"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049596 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           283387..283407
FT                   /locus_tag="Y57G11C.197"
FT                   /standard_name="Y57G11C.197"
FT                   /product="Hypothetical RNA transcript Y57G11C.197"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047107 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           216167..216187
FT                   /locus_tag="Y57G11C.198"
FT                   /standard_name="Y57G11C.198"
FT                   /product="Hypothetical RNA transcript Y57G11C.198"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044934 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232170..232190)
FT                   /locus_tag="Y57G11C.199"
FT                   /standard_name="Y57G11C.199"
FT                   /product="Hypothetical RNA transcript Y57G11C.199"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047513 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12177..12197
FT                   /locus_tag="Y57G11C.200"
FT                   /standard_name="Y57G11C.200"
FT                   /product="Hypothetical RNA transcript Y57G11C.200"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048407 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           43065..43085
FT                   /locus_tag="Y57G11C.201"
FT                   /standard_name="Y57G11C.201"
FT                   /product="Hypothetical RNA transcript Y57G11C.201"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044660 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119827..119847
FT                   /locus_tag="Y57G11C.202"
FT                   /standard_name="Y57G11C.202"
FT                   /product="Hypothetical RNA transcript Y57G11C.202"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048213 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           287611..287631
FT                   /locus_tag="Y57G11C.203"
FT                   /standard_name="Y57G11C.203"
FT                   /product="Hypothetical RNA transcript Y57G11C.203"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047094 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(55127..55147)
FT                   /locus_tag="Y57G11C.204"
FT                   /standard_name="Y57G11C.204"
FT                   /product="Hypothetical RNA transcript Y57G11C.204"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049740 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           65030..65050
FT                   /locus_tag="Y57G11C.205"
FT                   /standard_name="Y57G11C.205"
FT                   /product="Hypothetical RNA transcript Y57G11C.205"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045476 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           303211..303231
FT                   /locus_tag="Y57G11C.206"
FT                   /standard_name="Y57G11C.206"
FT                   /product="Hypothetical RNA transcript Y57G11C.206"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045870 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           302112..302132
FT                   /locus_tag="Y57G11C.207"
FT                   /standard_name="Y57G11C.207"
FT                   /product="Hypothetical RNA transcript Y57G11C.207"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045624 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           219770..219790
FT                   /locus_tag="Y57G11C.208"
FT                   /standard_name="Y57G11C.208"
FT                   /product="Hypothetical RNA transcript Y57G11C.208"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046546 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           171999..172019
FT                   /locus_tag="Y57G11C.209"
FT                   /standard_name="Y57G11C.209"
FT                   /product="Hypothetical RNA transcript Y57G11C.209"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046887 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(294219..294239)
FT                   /locus_tag="Y57G11C.210"
FT                   /standard_name="Y57G11C.210"
FT                   /product="Hypothetical RNA transcript Y57G11C.210"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048323 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(112343..112363)
FT                   /locus_tag="Y57G11C.211"
FT                   /standard_name="Y57G11C.211"
FT                   /product="Hypothetical RNA transcript Y57G11C.211"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046509 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           106403..106423
FT                   /locus_tag="Y57G11C.212"
FT                   /standard_name="Y57G11C.212"
FT                   /product="Hypothetical RNA transcript Y57G11C.212"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045169 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(93085..93105)
FT                   /locus_tag="Y57G11C.213"
FT                   /standard_name="Y57G11C.213"
FT                   /product="Hypothetical RNA transcript Y57G11C.213"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049305 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(276606..276626)
FT                   /locus_tag="Y57G11C.214"
FT                   /standard_name="Y57G11C.214"
FT                   /product="Hypothetical RNA transcript Y57G11C.214"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045674 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(24862..24882)
FT                   /locus_tag="Y57G11C.215"
FT                   /standard_name="Y57G11C.215"
FT                   /product="Hypothetical RNA transcript Y57G11C.215"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047870 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           268892..268912
FT                   /locus_tag="Y57G11C.216"
FT                   /standard_name="Y57G11C.216"
FT                   /product="Hypothetical RNA transcript Y57G11C.216"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046586 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           36488..36508
FT                   /locus_tag="Y57G11C.217"
FT                   /standard_name="Y57G11C.217"
FT                   /product="Hypothetical RNA transcript Y57G11C.217"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048106 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(15295..15315)
FT                   /locus_tag="Y57G11C.218"
FT                   /standard_name="Y57G11C.218"
FT                   /product="Hypothetical RNA transcript Y57G11C.218"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044588 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(307904..307924)
FT                   /locus_tag="Y57G11C.219"
FT                   /standard_name="Y57G11C.219"
FT                   /product="Hypothetical RNA transcript Y57G11C.219"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046741 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77484..77504)
FT                   /locus_tag="Y57G11C.220"
FT                   /standard_name="Y57G11C.220"
FT                   /product="Hypothetical RNA transcript Y57G11C.220"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049277 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(52837..52857)
FT                   /locus_tag="Y57G11C.221"
FT                   /standard_name="Y57G11C.221"
FT                   /product="Hypothetical RNA transcript Y57G11C.221"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046579 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           65612..65632
FT                   /locus_tag="Y57G11C.222"
FT                   /standard_name="Y57G11C.222"
FT                   /product="Hypothetical RNA transcript Y57G11C.222"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048721 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247355..247375
FT                   /locus_tag="Y57G11C.223"
FT                   /standard_name="Y57G11C.223"
FT                   /product="Hypothetical RNA transcript Y57G11C.223"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045327 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(36166..36186)
FT                   /locus_tag="Y57G11C.224"
FT                   /standard_name="Y57G11C.224"
FT                   /product="Hypothetical RNA transcript Y57G11C.224"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047204 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264804..264824
FT                   /locus_tag="Y57G11C.225"
FT                   /standard_name="Y57G11C.225"
FT                   /product="Hypothetical RNA transcript Y57G11C.225"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046877 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           252840..252860
FT                   /locus_tag="Y57G11C.226"
FT                   /standard_name="Y57G11C.226"
FT                   /product="Hypothetical RNA transcript Y57G11C.226"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044674 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(261188..261208)
FT                   /locus_tag="Y57G11C.227"
FT                   /standard_name="Y57G11C.227"
FT                   /product="Hypothetical RNA transcript Y57G11C.227"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046346 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(87915..87935)
FT                   /locus_tag="Y57G11C.228"
FT                   /standard_name="Y57G11C.228"
FT                   /product="Hypothetical RNA transcript Y57G11C.228"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047205 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           299904..299924
FT                   /locus_tag="Y57G11C.229"
FT                   /standard_name="Y57G11C.229"
FT                   /product="Hypothetical RNA transcript Y57G11C.229"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046332 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           278265..278285
FT                   /locus_tag="Y57G11C.230"
FT                   /standard_name="Y57G11C.230"
FT                   /product="Hypothetical RNA transcript Y57G11C.230"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048716 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           227474..227494
FT                   /locus_tag="Y57G11C.231"
FT                   /standard_name="Y57G11C.231"
FT                   /product="Hypothetical RNA transcript Y57G11C.231"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048341 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           235524..235544
FT                   /locus_tag="Y57G11C.232"
FT                   /standard_name="Y57G11C.232"
FT                   /product="Hypothetical RNA transcript Y57G11C.232"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045027 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(288351..288371)
FT                   /locus_tag="Y57G11C.233"
FT                   /standard_name="Y57G11C.233"
FT                   /product="Hypothetical RNA transcript Y57G11C.233"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048827 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(34850..34870)
FT                   /locus_tag="Y57G11C.234"
FT                   /standard_name="Y57G11C.234"
FT                   /product="Hypothetical RNA transcript Y57G11C.234"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047393 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           29854..29874
FT                   /locus_tag="Y57G11C.235"
FT                   /standard_name="Y57G11C.235"
FT                   /product="Hypothetical RNA transcript Y57G11C.235"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048948 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(105643..105663)
FT                   /locus_tag="Y57G11C.236"
FT                   /standard_name="Y57G11C.236"
FT                   /product="Hypothetical RNA transcript Y57G11C.236"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045389 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(233538..233558)
FT                   /locus_tag="Y57G11C.237"
FT                   /standard_name="Y57G11C.237"
FT                   /product="Hypothetical RNA transcript Y57G11C.237"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048596 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(242205..242225)
FT                   /locus_tag="Y57G11C.238"
FT                   /standard_name="Y57G11C.238"
FT                   /product="Hypothetical RNA transcript Y57G11C.238"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047872 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           125961..125981
FT                   /locus_tag="Y57G11C.239"
FT                   /standard_name="Y57G11C.239"
FT                   /product="Hypothetical RNA transcript Y57G11C.239"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048682 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(310054..310074)
FT                   /locus_tag="Y57G11C.240"
FT                   /standard_name="Y57G11C.240"
FT                   /product="Hypothetical RNA transcript Y57G11C.240"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047491 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(178620..178640)
FT                   /locus_tag="Y57G11C.241"
FT                   /standard_name="Y57G11C.241"
FT                   /product="Hypothetical RNA transcript Y57G11C.241"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045734 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           288340..288360
FT                   /locus_tag="Y57G11C.242"
FT                   /standard_name="Y57G11C.242"
FT                   /product="Hypothetical RNA transcript Y57G11C.242"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044617 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           289088..289108
FT                   /locus_tag="Y57G11C.243"
FT                   /standard_name="Y57G11C.243"
FT                   /product="Hypothetical RNA transcript Y57G11C.243"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049439 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           277839..277859
FT                   /locus_tag="Y57G11C.244"
FT                   /standard_name="Y57G11C.244"
FT                   /product="Hypothetical RNA transcript Y57G11C.244"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047274 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(41170..41190)
FT                   /locus_tag="Y57G11C.245"
FT                   /standard_name="Y57G11C.245"
FT                   /product="Hypothetical RNA transcript Y57G11C.245"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047640 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(113171..113191)
FT                   /locus_tag="Y57G11C.246"
FT                   /standard_name="Y57G11C.246"
FT                   /product="Hypothetical RNA transcript Y57G11C.246"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046968 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(69517..69537)
FT                   /locus_tag="Y57G11C.247"
FT                   /standard_name="Y57G11C.247"
FT                   /product="Hypothetical RNA transcript Y57G11C.247"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049388 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96942..96962
FT                   /locus_tag="Y57G11C.248"
FT                   /standard_name="Y57G11C.248"
FT                   /product="Hypothetical RNA transcript Y57G11C.248"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046024 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(97438..97458)
FT                   /locus_tag="Y57G11C.249"
FT                   /standard_name="Y57G11C.249"
FT                   /product="Hypothetical RNA transcript Y57G11C.249"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046974 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           89063..89083
FT                   /locus_tag="Y57G11C.250"
FT                   /standard_name="Y57G11C.250"
FT                   /product="Hypothetical RNA transcript Y57G11C.250"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046377 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199232..199252
FT                   /locus_tag="Y57G11C.251"
FT                   /standard_name="Y57G11C.251"
FT                   /product="Hypothetical RNA transcript Y57G11C.251"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049178 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(71461..71481)
FT                   /locus_tag="Y57G11C.252"
FT                   /standard_name="Y57G11C.252"
FT                   /product="Hypothetical RNA transcript Y57G11C.252"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049798 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           7589..7609
FT                   /locus_tag="Y57G11C.253"
FT                   /standard_name="Y57G11C.253"
FT                   /product="Hypothetical RNA transcript Y57G11C.253"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049529 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           260565..260585
FT                   /locus_tag="Y57G11C.254"
FT                   /standard_name="Y57G11C.254"
FT                   /product="Hypothetical RNA transcript Y57G11C.254"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047748 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           293311..293331
FT                   /locus_tag="Y57G11C.255"
FT                   /standard_name="Y57G11C.255"
FT                   /product="Hypothetical RNA transcript Y57G11C.255"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045328 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           15870..15890
FT                   /locus_tag="Y57G11C.256"
FT                   /standard_name="Y57G11C.256"
FT                   /product="Hypothetical RNA transcript Y57G11C.256"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046630 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(259955..259975)
FT                   /locus_tag="Y57G11C.257"
FT                   /standard_name="Y57G11C.257"
FT                   /product="Hypothetical RNA transcript Y57G11C.257"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046915 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           35882..35902
FT                   /locus_tag="Y57G11C.258"
FT                   /standard_name="Y57G11C.258"
FT                   /product="Hypothetical RNA transcript Y57G11C.258"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047029 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           44151..44171
FT                   /locus_tag="Y57G11C.259"
FT                   /standard_name="Y57G11C.259"
FT                   /product="Hypothetical RNA transcript Y57G11C.259"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048164 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           2587..2607
FT                   /locus_tag="Y57G11C.260"
FT                   /standard_name="Y57G11C.260"
FT                   /product="Hypothetical RNA transcript Y57G11C.260"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048261 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9212..9232)
FT                   /locus_tag="Y57G11C.261"
FT                   /standard_name="Y57G11C.261"
FT                   /product="Hypothetical RNA transcript Y57G11C.261"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045520 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(88220..88240)
FT                   /locus_tag="Y57G11C.262"
FT                   /standard_name="Y57G11C.262"
FT                   /product="Hypothetical RNA transcript Y57G11C.262"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049918 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           290080..290100
FT                   /locus_tag="Y57G11C.263"
FT                   /standard_name="Y57G11C.263"
FT                   /product="Hypothetical RNA transcript Y57G11C.263"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044712 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           236529..236549
FT                   /locus_tag="Y57G11C.264"
FT                   /standard_name="Y57G11C.264"
FT                   /product="Hypothetical RNA transcript Y57G11C.264"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045690 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           49496..49516
FT                   /locus_tag="Y57G11C.265"
FT                   /standard_name="Y57G11C.265"
FT                   /product="Hypothetical RNA transcript Y57G11C.265"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046567 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50411..50431
FT                   /locus_tag="Y57G11C.266"
FT                   /standard_name="Y57G11C.266"
FT                   /product="Hypothetical RNA transcript Y57G11C.266"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045966 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(67758..67778)
FT                   /locus_tag="Y57G11C.267"
FT                   /standard_name="Y57G11C.267"
FT                   /product="Hypothetical RNA transcript Y57G11C.267"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046032 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           259546..259566
FT                   /locus_tag="Y57G11C.268"
FT                   /standard_name="Y57G11C.268"
FT                   /product="Hypothetical RNA transcript Y57G11C.268"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048598 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(49077..49097)
FT                   /locus_tag="Y57G11C.269"
FT                   /standard_name="Y57G11C.269"
FT                   /product="Hypothetical RNA transcript Y57G11C.269"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045724 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(305647..305667)
FT                   /locus_tag="Y57G11C.270"
FT                   /standard_name="Y57G11C.270"
FT                   /product="Hypothetical RNA transcript Y57G11C.270"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049466 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(125298..125318)
FT                   /locus_tag="Y57G11C.271"
FT                   /standard_name="Y57G11C.271"
FT                   /product="Hypothetical RNA transcript Y57G11C.271"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047141 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(229158..229178)
FT                   /locus_tag="Y57G11C.272"
FT                   /standard_name="Y57G11C.272"
FT                   /product="Hypothetical RNA transcript Y57G11C.272"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047918 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(196701..196721)
FT                   /locus_tag="Y57G11C.273"
FT                   /standard_name="Y57G11C.273"
FT                   /product="Hypothetical RNA transcript Y57G11C.273"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048830 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11412..11432
FT                   /locus_tag="Y57G11C.274"
FT                   /standard_name="Y57G11C.274"
FT                   /product="Hypothetical RNA transcript Y57G11C.274"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046682 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           24490..24510
FT                   /locus_tag="Y57G11C.275"
FT                   /standard_name="Y57G11C.275"
FT                   /product="Hypothetical RNA transcript Y57G11C.275"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048460 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           278519..278539
FT                   /locus_tag="Y57G11C.276"
FT                   /standard_name="Y57G11C.276"
FT                   /product="Hypothetical RNA transcript Y57G11C.276"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049188 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(40295..40315)
FT                   /locus_tag="Y57G11C.277"
FT                   /standard_name="Y57G11C.277"
FT                   /product="Hypothetical RNA transcript Y57G11C.277"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048506 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           111348..111368
FT                   /locus_tag="Y57G11C.278"
FT                   /standard_name="Y57G11C.278"
FT                   /product="Hypothetical RNA transcript Y57G11C.278"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044827 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           23210..23230
FT                   /locus_tag="Y57G11C.279"
FT                   /standard_name="Y57G11C.279"
FT                   /product="Hypothetical RNA transcript Y57G11C.279"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048799 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(73840..73860)
FT                   /locus_tag="Y57G11C.280"
FT                   /standard_name="Y57G11C.280"
FT                   /product="Hypothetical RNA transcript Y57G11C.280"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046969 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(238659..238679)
FT                   /locus_tag="Y57G11C.281"
FT                   /standard_name="Y57G11C.281"
FT                   /product="Hypothetical RNA transcript Y57G11C.281"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048736 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(126587..126607)
FT                   /locus_tag="Y57G11C.282"
FT                   /standard_name="Y57G11C.282"
FT                   /product="Hypothetical RNA transcript Y57G11C.282"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047838 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(179618..179638)
FT                   /locus_tag="Y57G11C.283"
FT                   /standard_name="Y57G11C.283"
FT                   /product="Hypothetical RNA transcript Y57G11C.283"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046170 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           265590..265610
FT                   /locus_tag="Y57G11C.284"
FT                   /standard_name="Y57G11C.284"
FT                   /product="Hypothetical RNA transcript Y57G11C.284"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046557 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(94703..94723)
FT                   /locus_tag="Y57G11C.285"
FT                   /standard_name="Y57G11C.285"
FT                   /product="Hypothetical RNA transcript Y57G11C.285"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049617 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           40156..40176
FT                   /locus_tag="Y57G11C.286"
FT                   /standard_name="Y57G11C.286"
FT                   /product="Hypothetical RNA transcript Y57G11C.286"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048320 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(111862..111882)
FT                   /locus_tag="Y57G11C.287"
FT                   /standard_name="Y57G11C.287"
FT                   /product="Hypothetical RNA transcript Y57G11C.287"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048065 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           93607..93627
FT                   /locus_tag="Y57G11C.288"
FT                   /standard_name="Y57G11C.288"
FT                   /product="Hypothetical RNA transcript Y57G11C.288"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048670 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(79531..79551)
FT                   /locus_tag="Y57G11C.289"
FT                   /standard_name="Y57G11C.289"
FT                   /product="Hypothetical RNA transcript Y57G11C.289"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045119 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(124904..124924)
FT                   /locus_tag="Y57G11C.290"
FT                   /standard_name="Y57G11C.290"
FT                   /product="Hypothetical RNA transcript Y57G11C.290"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045489 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(44459..44479)
FT                   /locus_tag="Y57G11C.291"
FT                   /standard_name="Y57G11C.291"
FT                   /product="Hypothetical RNA transcript Y57G11C.291"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045269 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193141..193161
FT                   /locus_tag="Y57G11C.292"
FT                   /standard_name="Y57G11C.292"
FT                   /product="Hypothetical RNA transcript Y57G11C.292"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048235 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(7028..7048)
FT                   /locus_tag="Y57G11C.293"
FT                   /standard_name="Y57G11C.293"
FT                   /product="Hypothetical RNA transcript Y57G11C.293"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049229 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(44863..44883)
FT                   /locus_tag="Y57G11C.294"
FT                   /standard_name="Y57G11C.294"
FT                   /product="Hypothetical RNA transcript Y57G11C.294"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044811 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(231398..231418)
FT                   /locus_tag="Y57G11C.295"
FT                   /standard_name="Y57G11C.295"
FT                   /product="Hypothetical RNA transcript Y57G11C.295"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046217 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(83177..83197)
FT                   /locus_tag="Y57G11C.296"
FT                   /standard_name="Y57G11C.296"
FT                   /product="Hypothetical RNA transcript Y57G11C.296"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049892 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           115542..115562
FT                   /locus_tag="Y57G11C.297"
FT                   /standard_name="Y57G11C.297"
FT                   /product="Hypothetical RNA transcript Y57G11C.297"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048577 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(309031..309051)
FT                   /locus_tag="Y57G11C.298"
FT                   /standard_name="Y57G11C.298"
FT                   /product="Hypothetical RNA transcript Y57G11C.298"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048705 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(277020..277040)
FT                   /locus_tag="Y57G11C.299"
FT                   /standard_name="Y57G11C.299"
FT                   /product="Hypothetical RNA transcript Y57G11C.299"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045484 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(37632..37652)
FT                   /locus_tag="Y57G11C.300"
FT                   /standard_name="Y57G11C.300"
FT                   /product="Hypothetical RNA transcript Y57G11C.300"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046699 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           3264..3284
FT                   /locus_tag="Y57G11C.301"
FT                   /standard_name="Y57G11C.301"
FT                   /product="Hypothetical RNA transcript Y57G11C.301"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045066 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(4929..4949)
FT                   /locus_tag="Y57G11C.302"
FT                   /standard_name="Y57G11C.302"
FT                   /product="Hypothetical RNA transcript Y57G11C.302"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047347 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           44071..44091
FT                   /locus_tag="Y57G11C.303"
FT                   /standard_name="Y57G11C.303"
FT                   /product="Hypothetical RNA transcript Y57G11C.303"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046354 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           198504..198524
FT                   /locus_tag="Y57G11C.304"
FT                   /standard_name="Y57G11C.304"
FT                   /product="Hypothetical RNA transcript Y57G11C.304"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045583 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(48418..48438)
FT                   /locus_tag="Y57G11C.305"
FT                   /standard_name="Y57G11C.305"
FT                   /product="Hypothetical RNA transcript Y57G11C.305"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045460 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           42148..42168
FT                   /locus_tag="Y57G11C.306"
FT                   /standard_name="Y57G11C.306"
FT                   /product="Hypothetical RNA transcript Y57G11C.306"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047328 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(17014..17034)
FT                   /locus_tag="Y57G11C.307"
FT                   /standard_name="Y57G11C.307"
FT                   /product="Hypothetical RNA transcript Y57G11C.307"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044870 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(27287..27307)
FT                   /locus_tag="Y57G11C.308"
FT                   /standard_name="Y57G11C.308"
FT                   /product="Hypothetical RNA transcript Y57G11C.308"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049138 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           312807..312827
FT                   /locus_tag="Y57G11C.309"
FT                   /standard_name="Y57G11C.309"
FT                   /product="Hypothetical RNA transcript Y57G11C.309"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049584 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           309154..309174
FT                   /locus_tag="Y57G11C.310"
FT                   /standard_name="Y57G11C.310"
FT                   /product="Hypothetical RNA transcript Y57G11C.310"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049203 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(269410..269430)
FT                   /locus_tag="Y57G11C.311"
FT                   /standard_name="Y57G11C.311"
FT                   /product="Hypothetical RNA transcript Y57G11C.311"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049073 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(52057..52077)
FT                   /locus_tag="Y57G11C.312"
FT                   /standard_name="Y57G11C.312"
FT                   /product="Hypothetical RNA transcript Y57G11C.312"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046903 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           246320..246340
FT                   /locus_tag="Y57G11C.313"
FT                   /standard_name="Y57G11C.313"
FT                   /product="Hypothetical RNA transcript Y57G11C.313"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048518 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(73166..73186)
FT                   /locus_tag="Y57G11C.314"
FT                   /standard_name="Y57G11C.314"
FT                   /product="Hypothetical RNA transcript Y57G11C.314"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045816 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(45227..45247)
FT                   /locus_tag="Y57G11C.315"
FT                   /standard_name="Y57G11C.315"
FT                   /product="Hypothetical RNA transcript Y57G11C.315"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045648 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           211812..211832
FT                   /locus_tag="Y57G11C.316"
FT                   /standard_name="Y57G11C.316"
FT                   /product="Hypothetical RNA transcript Y57G11C.316"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047674 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(191541..191561)
FT                   /locus_tag="Y57G11C.317"
FT                   /standard_name="Y57G11C.317"
FT                   /product="Hypothetical RNA transcript Y57G11C.317"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047439 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           8223..8243
FT                   /locus_tag="Y57G11C.318"
FT                   /standard_name="Y57G11C.318"
FT                   /product="Hypothetical RNA transcript Y57G11C.318"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046304 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           200047..200067
FT                   /locus_tag="Y57G11C.319"
FT                   /standard_name="Y57G11C.319"
FT                   /product="Hypothetical RNA transcript Y57G11C.319"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047946 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(6542..6562)
FT                   /locus_tag="Y57G11C.320"
FT                   /standard_name="Y57G11C.320"
FT                   /product="Hypothetical RNA transcript Y57G11C.320"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049769 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29050..29070)
FT                   /locus_tag="Y57G11C.321"
FT                   /standard_name="Y57G11C.321"
FT                   /product="Hypothetical RNA transcript Y57G11C.321"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049966 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(22935..22955)
FT                   /locus_tag="Y57G11C.322"
FT                   /standard_name="Y57G11C.322"
FT                   /product="Hypothetical RNA transcript Y57G11C.322"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047002 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(76270..76290)
FT                   /locus_tag="Y57G11C.323"
FT                   /standard_name="Y57G11C.323"
FT                   /product="Hypothetical RNA transcript Y57G11C.323"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049318 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233306..233326
FT                   /locus_tag="Y57G11C.324"
FT                   /standard_name="Y57G11C.324"
FT                   /product="Hypothetical RNA transcript Y57G11C.324"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048471 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(248029..248049)
FT                   /locus_tag="Y57G11C.325"
FT                   /standard_name="Y57G11C.325"
FT                   /product="Hypothetical RNA transcript Y57G11C.325"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048655 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(28479..28499)
FT                   /locus_tag="Y57G11C.326"
FT                   /standard_name="Y57G11C.326"
FT                   /product="Hypothetical RNA transcript Y57G11C.326"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045715 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           37936..37956
FT                   /locus_tag="Y57G11C.327"
FT                   /standard_name="Y57G11C.327"
FT                   /product="Hypothetical RNA transcript Y57G11C.327"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048404 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           211446..211466
FT                   /locus_tag="Y57G11C.328"
FT                   /standard_name="Y57G11C.328"
FT                   /product="Hypothetical RNA transcript Y57G11C.328"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048085 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(213883..213903)
FT                   /locus_tag="Y57G11C.329"
FT                   /standard_name="Y57G11C.329"
FT                   /product="Hypothetical RNA transcript Y57G11C.329"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046812 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           262797..262817
FT                   /locus_tag="Y57G11C.330"
FT                   /standard_name="Y57G11C.330"
FT                   /product="Hypothetical RNA transcript Y57G11C.330"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047647 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(70940..70960)
FT                   /locus_tag="Y57G11C.331"
FT                   /standard_name="Y57G11C.331"
FT                   /product="Hypothetical RNA transcript Y57G11C.331"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048627 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           313142..313162
FT                   /locus_tag="Y57G11C.332"
FT                   /standard_name="Y57G11C.332"
FT                   /product="Hypothetical RNA transcript Y57G11C.332"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045828 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           53058..53078
FT                   /locus_tag="Y57G11C.333"
FT                   /standard_name="Y57G11C.333"
FT                   /product="Hypothetical RNA transcript Y57G11C.333"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044889 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(272543..272563)
FT                   /locus_tag="Y57G11C.334"
FT                   /standard_name="Y57G11C.334"
FT                   /product="Hypothetical RNA transcript Y57G11C.334"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046492 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(78693..78713)
FT                   /locus_tag="Y57G11C.335"
FT                   /standard_name="Y57G11C.335"
FT                   /product="Hypothetical RNA transcript Y57G11C.335"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045779 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           63664..63684
FT                   /locus_tag="Y57G11C.336"
FT                   /standard_name="Y57G11C.336"
FT                   /product="Hypothetical RNA transcript Y57G11C.336"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049949 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           63059..63079
FT                   /locus_tag="Y57G11C.337"
FT                   /standard_name="Y57G11C.337"
FT                   /product="Hypothetical RNA transcript Y57G11C.337"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047159 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(45092..45112)
FT                   /locus_tag="Y57G11C.338"
FT                   /standard_name="Y57G11C.338"
FT                   /product="Hypothetical RNA transcript Y57G11C.338"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046921 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306137..306157)
FT                   /locus_tag="Y57G11C.339"
FT                   /standard_name="Y57G11C.339"
FT                   /product="Hypothetical RNA transcript Y57G11C.339"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047273 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           2822..2842
FT                   /locus_tag="Y57G11C.340"
FT                   /standard_name="Y57G11C.340"
FT                   /product="Hypothetical RNA transcript Y57G11C.340"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049065 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           196146..196166
FT                   /locus_tag="Y57G11C.341"
FT                   /standard_name="Y57G11C.341"
FT                   /product="Hypothetical RNA transcript Y57G11C.341"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049264 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           213195..213215
FT                   /locus_tag="Y57G11C.342"
FT                   /standard_name="Y57G11C.342"
FT                   /product="Hypothetical RNA transcript Y57G11C.342"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045156 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(226976..226996)
FT                   /locus_tag="Y57G11C.343"
FT                   /standard_name="Y57G11C.343"
FT                   /product="Hypothetical RNA transcript Y57G11C.343"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047763 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           5541..5561
FT                   /locus_tag="Y57G11C.344"
FT                   /standard_name="Y57G11C.344"
FT                   /product="Hypothetical RNA transcript Y57G11C.344"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045869 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(280227..280247)
FT                   /locus_tag="Y57G11C.345"
FT                   /standard_name="Y57G11C.345"
FT                   /product="Hypothetical RNA transcript Y57G11C.345"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046845 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(262365..262385)
FT                   /locus_tag="Y57G11C.346"
FT                   /standard_name="Y57G11C.346"
FT                   /product="Hypothetical RNA transcript Y57G11C.346"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049189 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           60707..60727
FT                   /locus_tag="Y57G11C.347"
FT                   /standard_name="Y57G11C.347"
FT                   /product="Hypothetical RNA transcript Y57G11C.347"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045874 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(80535..80555)
FT                   /locus_tag="Y57G11C.348"
FT                   /standard_name="Y57G11C.348"
FT                   /product="Hypothetical RNA transcript Y57G11C.348"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046009 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(16316..16336)
FT                   /locus_tag="Y57G11C.349"
FT                   /standard_name="Y57G11C.349"
FT                   /product="Hypothetical RNA transcript Y57G11C.349"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047789 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233678..233698
FT                   /locus_tag="Y57G11C.350"
FT                   /standard_name="Y57G11C.350"
FT                   /product="Hypothetical RNA transcript Y57G11C.350"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047474 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           180085..180105
FT                   /locus_tag="Y57G11C.351"
FT                   /standard_name="Y57G11C.351"
FT                   /product="Hypothetical RNA transcript Y57G11C.351"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049961 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           31107..31127
FT                   /locus_tag="Y57G11C.352"
FT                   /standard_name="Y57G11C.352"
FT                   /product="Hypothetical RNA transcript Y57G11C.352"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044924 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           179388..179408
FT                   /locus_tag="Y57G11C.353"
FT                   /standard_name="Y57G11C.353"
FT                   /product="Hypothetical RNA transcript Y57G11C.353"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046975 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(31750..31770)
FT                   /locus_tag="Y57G11C.354"
FT                   /standard_name="Y57G11C.354"
FT                   /product="Hypothetical RNA transcript Y57G11C.354"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044976 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           269887..269907
FT                   /locus_tag="Y57G11C.355"
FT                   /standard_name="Y57G11C.355"
FT                   /product="Hypothetical RNA transcript Y57G11C.355"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048453 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306601..306621)
FT                   /locus_tag="Y57G11C.356"
FT                   /standard_name="Y57G11C.356"
FT                   /product="Hypothetical RNA transcript Y57G11C.356"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046405 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(276211..276231)
FT                   /locus_tag="Y57G11C.357"
FT                   /standard_name="Y57G11C.357"
FT                   /product="Hypothetical RNA transcript Y57G11C.357"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049191 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(82487..82507)
FT                   /locus_tag="Y57G11C.358"
FT                   /standard_name="Y57G11C.358"
FT                   /product="Hypothetical RNA transcript Y57G11C.358"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047550 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           248261..248281
FT                   /locus_tag="Y57G11C.359"
FT                   /standard_name="Y57G11C.359"
FT                   /product="Hypothetical RNA transcript Y57G11C.359"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046411 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           94657..94677
FT                   /locus_tag="Y57G11C.360"
FT                   /standard_name="Y57G11C.360"
FT                   /product="Hypothetical RNA transcript Y57G11C.360"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045784 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270294..270314
FT                   /locus_tag="Y57G11C.361"
FT                   /standard_name="Y57G11C.361"
FT                   /product="Hypothetical RNA transcript Y57G11C.361"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046202 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119580..119600
FT                   /locus_tag="Y57G11C.362"
FT                   /standard_name="Y57G11C.362"
FT                   /product="Hypothetical RNA transcript Y57G11C.362"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047279 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           5673..5693
FT                   /locus_tag="Y57G11C.363"
FT                   /standard_name="Y57G11C.363"
FT                   /product="Hypothetical RNA transcript Y57G11C.363"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045557 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(25763..25783)
FT                   /locus_tag="Y57G11C.364"
FT                   /standard_name="Y57G11C.364"
FT                   /product="Hypothetical RNA transcript Y57G11C.364"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044777 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(16119..16139)
FT                   /locus_tag="Y57G11C.365"
FT                   /standard_name="Y57G11C.365"
FT                   /product="Hypothetical RNA transcript Y57G11C.365"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046685 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           230995..231015
FT                   /locus_tag="Y57G11C.366"
FT                   /standard_name="Y57G11C.366"
FT                   /product="Hypothetical RNA transcript Y57G11C.366"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046724 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(280228..280248)
FT                   /locus_tag="Y57G11C.367"
FT                   /standard_name="Y57G11C.367"
FT                   /product="Hypothetical RNA transcript Y57G11C.367"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048035 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(10194..10214)
FT                   /locus_tag="Y57G11C.368"
FT                   /standard_name="Y57G11C.368"
FT                   /product="Hypothetical RNA transcript Y57G11C.368"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049643 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           309704..309724
FT                   /locus_tag="Y57G11C.369"
FT                   /standard_name="Y57G11C.369"
FT                   /product="Hypothetical RNA transcript Y57G11C.369"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045944 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(12752..12772)
FT                   /locus_tag="Y57G11C.370"
FT                   /standard_name="Y57G11C.370"
FT                   /product="Hypothetical RNA transcript Y57G11C.370"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047911 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           309873..309893
FT                   /locus_tag="Y57G11C.371"
FT                   /standard_name="Y57G11C.371"
FT                   /product="Hypothetical RNA transcript Y57G11C.371"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049878 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           104166..104186
FT                   /locus_tag="Y57G11C.372"
FT                   /standard_name="Y57G11C.372"
FT                   /product="Hypothetical RNA transcript Y57G11C.372"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF050005 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           224759..224779
FT                   /locus_tag="Y57G11C.373"
FT                   /standard_name="Y57G11C.373"
FT                   /product="Hypothetical RNA transcript Y57G11C.373"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047133 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107920..107940
FT                   /locus_tag="Y57G11C.374"
FT                   /standard_name="Y57G11C.374"
FT                   /product="Hypothetical RNA transcript Y57G11C.374"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049425 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(113615..113635)
FT                   /locus_tag="Y57G11C.375"
FT                   /standard_name="Y57G11C.375"
FT                   /product="Hypothetical RNA transcript Y57G11C.375"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049898 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           175486..175506
FT                   /locus_tag="Y57G11C.376"
FT                   /standard_name="Y57G11C.376"
FT                   /product="Hypothetical RNA transcript Y57G11C.376"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046077 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           289461..289481
FT                   /locus_tag="Y57G11C.377"
FT                   /standard_name="Y57G11C.377"
FT                   /product="Hypothetical RNA transcript Y57G11C.377"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045012 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           75922..75942
FT                   /locus_tag="Y57G11C.378"
FT                   /standard_name="Y57G11C.378"
FT                   /product="Hypothetical RNA transcript Y57G11C.378"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049870 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47198..47218)
FT                   /locus_tag="Y57G11C.379"
FT                   /standard_name="Y57G11C.379"
FT                   /product="Hypothetical RNA transcript Y57G11C.379"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048818 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(102020..102040)
FT                   /locus_tag="Y57G11C.380"
FT                   /standard_name="Y57G11C.380"
FT                   /product="Hypothetical RNA transcript Y57G11C.380"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046523 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50735..50755
FT                   /locus_tag="Y57G11C.381"
FT                   /standard_name="Y57G11C.381"
FT                   /product="Hypothetical RNA transcript Y57G11C.381"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047969 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(86561..86581)
FT                   /locus_tag="Y57G11C.382"
FT                   /standard_name="Y57G11C.382"
FT                   /product="Hypothetical RNA transcript Y57G11C.382"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049234 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(297022..297042)
FT                   /locus_tag="Y57G11C.383"
FT                   /standard_name="Y57G11C.383"
FT                   /product="Hypothetical RNA transcript Y57G11C.383"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046219 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(100206..100226)
FT                   /locus_tag="Y57G11C.384"
FT                   /standard_name="Y57G11C.384"
FT                   /product="Hypothetical RNA transcript Y57G11C.384"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046381 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(291507..291527)
FT                   /locus_tag="Y57G11C.385"
FT                   /standard_name="Y57G11C.385"
FT                   /product="Hypothetical RNA transcript Y57G11C.385"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045862 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           85799..85819
FT                   /locus_tag="Y57G11C.386"
FT                   /standard_name="Y57G11C.386"
FT                   /product="Hypothetical RNA transcript Y57G11C.386"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048142 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11304..11324
FT                   /locus_tag="Y57G11C.387"
FT                   /standard_name="Y57G11C.387"
FT                   /product="Hypothetical RNA transcript Y57G11C.387"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047453 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(3642..3662)
FT                   /locus_tag="Y57G11C.388"
FT                   /standard_name="Y57G11C.388"
FT                   /product="Hypothetical RNA transcript Y57G11C.388"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046229 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195797..195817)
FT                   /locus_tag="Y57G11C.389"
FT                   /standard_name="Y57G11C.389"
FT                   /product="Hypothetical RNA transcript Y57G11C.389"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044912 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           65034..65054
FT                   /locus_tag="Y57G11C.390"
FT                   /standard_name="Y57G11C.390"
FT                   /product="Hypothetical RNA transcript Y57G11C.390"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048550 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           100206..100226
FT                   /locus_tag="Y57G11C.391"
FT                   /standard_name="Y57G11C.391"
FT                   /product="Hypothetical RNA transcript Y57G11C.391"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045111 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           286705..286725
FT                   /locus_tag="Y57G11C.392"
FT                   /standard_name="Y57G11C.392"
FT                   /product="Hypothetical RNA transcript Y57G11C.392"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047811 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(104031..104051)
FT                   /locus_tag="Y57G11C.393"
FT                   /standard_name="Y57G11C.393"
FT                   /product="Hypothetical RNA transcript Y57G11C.393"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048912 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(271479..271499)
FT                   /locus_tag="Y57G11C.394"
FT                   /standard_name="Y57G11C.394"
FT                   /product="Hypothetical RNA transcript Y57G11C.394"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049494 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           41936..41956
FT                   /locus_tag="Y57G11C.395"
FT                   /standard_name="Y57G11C.395"
FT                   /product="Hypothetical RNA transcript Y57G11C.395"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047699 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30727..30747
FT                   /locus_tag="Y57G11C.396"
FT                   /standard_name="Y57G11C.396"
FT                   /product="Hypothetical RNA transcript Y57G11C.396"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046953 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264077..264097
FT                   /locus_tag="Y57G11C.397"
FT                   /standard_name="Y57G11C.397"
FT                   /product="Hypothetical RNA transcript Y57G11C.397"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047943 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           263861..263881
FT                   /locus_tag="Y57G11C.398"
FT                   /standard_name="Y57G11C.398"
FT                   /product="Hypothetical RNA transcript Y57G11C.398"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048053 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(72728..72748)
FT                   /locus_tag="Y57G11C.399"
FT                   /standard_name="Y57G11C.399"
FT                   /product="Hypothetical RNA transcript Y57G11C.399"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047739 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           283764..283784
FT                   /locus_tag="Y57G11C.400"
FT                   /standard_name="Y57G11C.400"
FT                   /product="Hypothetical RNA transcript Y57G11C.400"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047806 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(304927..304947)
FT                   /locus_tag="Y57G11C.401"
FT                   /standard_name="Y57G11C.401"
FT                   /product="Hypothetical RNA transcript Y57G11C.401"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049873 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(62677..62697)
FT                   /locus_tag="Y57G11C.402"
FT                   /standard_name="Y57G11C.402"
FT                   /product="Hypothetical RNA transcript Y57G11C.402"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046653 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           287947..287967
FT                   /locus_tag="Y57G11C.403"
FT                   /standard_name="Y57G11C.403"
FT                   /product="Hypothetical RNA transcript Y57G11C.403"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045337 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           266612..266632
FT                   /locus_tag="Y57G11C.404"
FT                   /standard_name="Y57G11C.404"
FT                   /product="Hypothetical RNA transcript Y57G11C.404"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048012 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306604..306624)
FT                   /locus_tag="Y57G11C.405"
FT                   /standard_name="Y57G11C.405"
FT                   /product="Hypothetical RNA transcript Y57G11C.405"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049867 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(41353..41373)
FT                   /locus_tag="Y57G11C.406"
FT                   /standard_name="Y57G11C.406"
FT                   /product="Hypothetical RNA transcript Y57G11C.406"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047080 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(271562..271582)
FT                   /locus_tag="Y57G11C.407"
FT                   /standard_name="Y57G11C.407"
FT                   /product="Hypothetical RNA transcript Y57G11C.407"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048686 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           99917..99937
FT                   /locus_tag="Y57G11C.408"
FT                   /standard_name="Y57G11C.408"
FT                   /product="Hypothetical RNA transcript Y57G11C.408"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047468 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           16771..16791
FT                   /locus_tag="Y57G11C.409"
FT                   /standard_name="Y57G11C.409"
FT                   /product="Hypothetical RNA transcript Y57G11C.409"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048619 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           267231..267251
FT                   /locus_tag="Y57G11C.410"
FT                   /standard_name="Y57G11C.410"
FT                   /product="Hypothetical RNA transcript Y57G11C.410"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048572 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           198863..198883
FT                   /locus_tag="Y57G11C.411"
FT                   /standard_name="Y57G11C.411"
FT                   /product="Hypothetical RNA transcript Y57G11C.411"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047529 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           258403..258423
FT                   /locus_tag="Y57G11C.412"
FT                   /standard_name="Y57G11C.412"
FT                   /product="Hypothetical RNA transcript Y57G11C.412"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048048 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           174782..174802
FT                   /locus_tag="Y57G11C.413"
FT                   /standard_name="Y57G11C.413"
FT                   /product="Hypothetical RNA transcript Y57G11C.413"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045805 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(238839..238859)
FT                   /locus_tag="Y57G11C.414"
FT                   /standard_name="Y57G11C.414"
FT                   /product="Hypothetical RNA transcript Y57G11C.414"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046162 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(70527..70547)
FT                   /locus_tag="Y57G11C.415"
FT                   /standard_name="Y57G11C.415"
FT                   /product="Hypothetical RNA transcript Y57G11C.415"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049491 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           212579..212599
FT                   /locus_tag="Y57G11C.416"
FT                   /standard_name="Y57G11C.416"
FT                   /product="Hypothetical RNA transcript Y57G11C.416"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049542 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(228997..229017)
FT                   /locus_tag="Y57G11C.417"
FT                   /standard_name="Y57G11C.417"
FT                   /product="Hypothetical RNA transcript Y57G11C.417"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049087 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199291..199311
FT                   /locus_tag="Y57G11C.418"
FT                   /standard_name="Y57G11C.418"
FT                   /product="Hypothetical RNA transcript Y57G11C.418"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044621 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(217613..217633)
FT                   /locus_tag="Y57G11C.419"
FT                   /standard_name="Y57G11C.419"
FT                   /product="Hypothetical RNA transcript Y57G11C.419"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046882 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           116085..116105
FT                   /locus_tag="Y57G11C.420"
FT                   /standard_name="Y57G11C.420"
FT                   /product="Hypothetical RNA transcript Y57G11C.420"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044894 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           32370..32390
FT                   /locus_tag="Y57G11C.421"
FT                   /standard_name="Y57G11C.421"
FT                   /product="Hypothetical RNA transcript Y57G11C.421"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049373 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           266999..267019
FT                   /locus_tag="Y57G11C.422"
FT                   /standard_name="Y57G11C.422"
FT                   /product="Hypothetical RNA transcript Y57G11C.422"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047681 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(227095..227115)
FT                   /locus_tag="Y57G11C.423"
FT                   /standard_name="Y57G11C.423"
FT                   /product="Hypothetical RNA transcript Y57G11C.423"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049088 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(256378..256398)
FT                   /locus_tag="Y57G11C.424"
FT                   /standard_name="Y57G11C.424"
FT                   /product="Hypothetical RNA transcript Y57G11C.424"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045759 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           95962..95982
FT                   /locus_tag="Y57G11C.425"
FT                   /standard_name="Y57G11C.425"
FT                   /product="Hypothetical RNA transcript Y57G11C.425"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046763 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(245568..245588)
FT                   /locus_tag="Y57G11C.426"
FT                   /standard_name="Y57G11C.426"
FT                   /product="Hypothetical RNA transcript Y57G11C.426"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046401 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30923..30943
FT                   /locus_tag="Y57G11C.427"
FT                   /standard_name="Y57G11C.427"
FT                   /product="Hypothetical RNA transcript Y57G11C.427"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046543 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9745..9765)
FT                   /locus_tag="Y57G11C.428"
FT                   /standard_name="Y57G11C.428"
FT                   /product="Hypothetical RNA transcript Y57G11C.428"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045761 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           79840..79860
FT                   /locus_tag="Y57G11C.429"
FT                   /standard_name="Y57G11C.429"
FT                   /product="Hypothetical RNA transcript Y57G11C.429"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046615 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           193595..193615
FT                   /locus_tag="Y57G11C.430"
FT                   /standard_name="Y57G11C.430"
FT                   /product="Hypothetical RNA transcript Y57G11C.430"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045296 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           308792..308812
FT                   /locus_tag="Y57G11C.431"
FT                   /standard_name="Y57G11C.431"
FT                   /product="Hypothetical RNA transcript Y57G11C.431"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048644 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           253279..253299
FT                   /locus_tag="Y57G11C.432"
FT                   /standard_name="Y57G11C.432"
FT                   /product="Hypothetical RNA transcript Y57G11C.432"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049165 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195683..195703)
FT                   /locus_tag="Y57G11C.433"
FT                   /standard_name="Y57G11C.433"
FT                   /product="Hypothetical RNA transcript Y57G11C.433"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046652 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           175143..175163
FT                   /locus_tag="Y57G11C.434"
FT                   /standard_name="Y57G11C.434"
FT                   /product="Hypothetical RNA transcript Y57G11C.434"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044681 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           251591..251611
FT                   /locus_tag="Y57G11C.435"
FT                   /standard_name="Y57G11C.435"
FT                   /product="Hypothetical RNA transcript Y57G11C.435"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046811 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(91328..91348)
FT                   /locus_tag="Y57G11C.436"
FT                   /standard_name="Y57G11C.436"
FT                   /product="Hypothetical RNA transcript Y57G11C.436"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047694 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(311646..311666)
FT                   /locus_tag="Y57G11C.437"
FT                   /standard_name="Y57G11C.437"
FT                   /product="Hypothetical RNA transcript Y57G11C.437"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047722 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(168591..168611)
FT                   /locus_tag="Y57G11C.438"
FT                   /standard_name="Y57G11C.438"
FT                   /product="Hypothetical RNA transcript Y57G11C.438"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048520 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           280813..280833
FT                   /locus_tag="Y57G11C.439"
FT                   /standard_name="Y57G11C.439"
FT                   /product="Hypothetical RNA transcript Y57G11C.439"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046396 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           3022..3042
FT                   /locus_tag="Y57G11C.440"
FT                   /standard_name="Y57G11C.440"
FT                   /product="Hypothetical RNA transcript Y57G11C.440"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044635 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(244065..244085)
FT                   /locus_tag="Y57G11C.441"
FT                   /standard_name="Y57G11C.441"
FT                   /product="Hypothetical RNA transcript Y57G11C.441"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048817 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(243095..243115)
FT                   /locus_tag="Y57G11C.442"
FT                   /standard_name="Y57G11C.442"
FT                   /product="Hypothetical RNA transcript Y57G11C.442"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048621 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(58823..58843)
FT                   /locus_tag="Y57G11C.443"
FT                   /standard_name="Y57G11C.443"
FT                   /product="Hypothetical RNA transcript Y57G11C.443"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045539 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           267091..267111
FT                   /locus_tag="Y57G11C.444"
FT                   /standard_name="Y57G11C.444"
FT                   /product="Hypothetical RNA transcript Y57G11C.444"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049784 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           176321..176341
FT                   /locus_tag="Y57G11C.445"
FT                   /standard_name="Y57G11C.445"
FT                   /product="Hypothetical RNA transcript Y57G11C.445"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047017 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           179610..179630
FT                   /locus_tag="Y57G11C.446"
FT                   /standard_name="Y57G11C.446"
FT                   /product="Hypothetical RNA transcript Y57G11C.446"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049932 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(85069..85089)
FT                   /locus_tag="Y57G11C.447"
FT                   /standard_name="Y57G11C.447"
FT                   /product="Hypothetical RNA transcript Y57G11C.447"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045289 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(67881..67901)
FT                   /locus_tag="Y57G11C.448"
FT                   /standard_name="Y57G11C.448"
FT                   /product="Hypothetical RNA transcript Y57G11C.448"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048311 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232331..232351)
FT                   /locus_tag="Y57G11C.449"
FT                   /standard_name="Y57G11C.449"
FT                   /product="Hypothetical RNA transcript Y57G11C.449"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048450 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(196544..196564)
FT                   /locus_tag="Y57G11C.450"
FT                   /standard_name="Y57G11C.450"
FT                   /product="Hypothetical RNA transcript Y57G11C.450"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045297 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(278319..278339)
FT                   /locus_tag="Y57G11C.451"
FT                   /standard_name="Y57G11C.451"
FT                   /product="Hypothetical RNA transcript Y57G11C.451"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044850 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(14616..14636)
FT                   /locus_tag="Y57G11C.452"
FT                   /standard_name="Y57G11C.452"
FT                   /product="Hypothetical RNA transcript Y57G11C.452"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045294 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232173..232193)
FT                   /locus_tag="Y57G11C.453"
FT                   /standard_name="Y57G11C.453"
FT                   /product="Hypothetical RNA transcript Y57G11C.453"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045475 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9883..9903)
FT                   /locus_tag="Y57G11C.454"
FT                   /standard_name="Y57G11C.454"
FT                   /product="Hypothetical RNA transcript Y57G11C.454"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046988 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           236133..236153
FT                   /locus_tag="Y57G11C.455"
FT                   /standard_name="Y57G11C.455"
FT                   /product="Hypothetical RNA transcript Y57G11C.455"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045339 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(86148..86168)
FT                   /locus_tag="Y57G11C.456"
FT                   /standard_name="Y57G11C.456"
FT                   /product="Hypothetical RNA transcript Y57G11C.456"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047582 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(34603..34623)
FT                   /locus_tag="Y57G11C.457"
FT                   /standard_name="Y57G11C.457"
FT                   /product="Hypothetical RNA transcript Y57G11C.457"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044883 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270349..270369
FT                   /locus_tag="Y57G11C.458"
FT                   /standard_name="Y57G11C.458"
FT                   /product="Hypothetical RNA transcript Y57G11C.458"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044902 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           174688..174708
FT                   /locus_tag="Y57G11C.459"
FT                   /standard_name="Y57G11C.459"
FT                   /product="Hypothetical RNA transcript Y57G11C.459"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045651 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233679..233699
FT                   /locus_tag="Y57G11C.460"
FT                   /standard_name="Y57G11C.460"
FT                   /product="Hypothetical RNA transcript Y57G11C.460"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049935 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(40894..40914)
FT                   /locus_tag="Y57G11C.461"
FT                   /standard_name="Y57G11C.461"
FT                   /product="Hypothetical RNA transcript Y57G11C.461"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045390 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(101881..101901)
FT                   /locus_tag="Y57G11C.462"
FT                   /standard_name="Y57G11C.462"
FT                   /product="Hypothetical RNA transcript Y57G11C.462"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046512 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           99726..99746
FT                   /locus_tag="Y57G11C.463"
FT                   /standard_name="Y57G11C.463"
FT                   /product="Hypothetical RNA transcript Y57G11C.463"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048510 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(104904..104924)
FT                   /locus_tag="Y57G11C.464"
FT                   /standard_name="Y57G11C.464"
FT                   /product="Hypothetical RNA transcript Y57G11C.464"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045830 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(177368..177388)
FT                   /locus_tag="Y57G11C.465"
FT                   /standard_name="Y57G11C.465"
FT                   /product="Hypothetical RNA transcript Y57G11C.465"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049445 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(39635..39655)
FT                   /locus_tag="Y57G11C.466"
FT                   /standard_name="Y57G11C.466"
FT                   /product="Hypothetical RNA transcript Y57G11C.466"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049428 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           254157..254177
FT                   /locus_tag="Y57G11C.467"
FT                   /standard_name="Y57G11C.467"
FT                   /product="Hypothetical RNA transcript Y57G11C.467"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046080 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           271253..271273
FT                   /locus_tag="Y57G11C.468"
FT                   /standard_name="Y57G11C.468"
FT                   /product="Hypothetical RNA transcript Y57G11C.468"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045551 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(293022..293042)
FT                   /locus_tag="Y57G11C.469"
FT                   /standard_name="Y57G11C.469"
FT                   /product="Hypothetical RNA transcript Y57G11C.469"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045208 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120623..120643
FT                   /locus_tag="Y57G11C.470"
FT                   /standard_name="Y57G11C.470"
FT                   /product="Hypothetical RNA transcript Y57G11C.470"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049901 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           283899..283919
FT                   /locus_tag="Y57G11C.471"
FT                   /standard_name="Y57G11C.471"
FT                   /product="Hypothetical RNA transcript Y57G11C.471"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045081 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(12974..12994)
FT                   /locus_tag="Y57G11C.472"
FT                   /standard_name="Y57G11C.472"
FT                   /product="Hypothetical RNA transcript Y57G11C.472"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049881 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107669..107689
FT                   /locus_tag="Y57G11C.473"
FT                   /standard_name="Y57G11C.473"
FT                   /product="Hypothetical RNA transcript Y57G11C.473"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047332 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           176830..176850
FT                   /locus_tag="Y57G11C.474"
FT                   /standard_name="Y57G11C.474"
FT                   /product="Hypothetical RNA transcript Y57G11C.474"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046761 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(109306..109326)
FT                   /locus_tag="Y57G11C.475"
FT                   /standard_name="Y57G11C.475"
FT                   /product="Hypothetical RNA transcript Y57G11C.475"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045652 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(274516..274536)
FT                   /locus_tag="Y57G11C.476"
FT                   /standard_name="Y57G11C.476"
FT                   /product="Hypothetical RNA transcript Y57G11C.476"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045022 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306220..306240)
FT                   /locus_tag="Y57G11C.477"
FT                   /standard_name="Y57G11C.477"
FT                   /product="Hypothetical RNA transcript Y57G11C.477"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047392 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(240102..240122)
FT                   /locus_tag="Y57G11C.478"
FT                   /standard_name="Y57G11C.478"
FT                   /product="Hypothetical RNA transcript Y57G11C.478"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046629 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(243812..243832)
FT                   /locus_tag="Y57G11C.479"
FT                   /standard_name="Y57G11C.479"
FT                   /product="Hypothetical RNA transcript Y57G11C.479"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF044735 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50583..50603
FT                   /locus_tag="Y57G11C.480"
FT                   /standard_name="Y57G11C.480"
FT                   /product="Hypothetical RNA transcript Y57G11C.480"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047557 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(194230..194250)
FT                   /locus_tag="Y57G11C.481"
FT                   /standard_name="Y57G11C.481"
FT                   /product="Hypothetical RNA transcript Y57G11C.481"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049916 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281486..281506
FT                   /locus_tag="Y57G11C.482"
FT                   /standard_name="Y57G11C.482"
FT                   /product="Hypothetical RNA transcript Y57G11C.482"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045496 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           194723..194743
FT                   /locus_tag="Y57G11C.483"
FT                   /standard_name="Y57G11C.483"
FT                   /product="Hypothetical RNA transcript Y57G11C.483"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048264 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(278316..278336)
FT                   /locus_tag="Y57G11C.484"
FT                   /standard_name="Y57G11C.484"
FT                   /product="Hypothetical RNA transcript Y57G11C.484"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045593 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47733..47753)
FT                   /locus_tag="Y57G11C.485"
FT                   /standard_name="Y57G11C.485"
FT                   /product="Hypothetical RNA transcript Y57G11C.485"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046894 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9886..9906)
FT                   /locus_tag="Y57G11C.486"
FT                   /standard_name="Y57G11C.486"
FT                   /product="Hypothetical RNA transcript Y57G11C.486"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046506 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           26677..26697
FT                   /locus_tag="Y57G11C.487"
FT                   /standard_name="Y57G11C.487"
FT                   /product="Hypothetical RNA transcript Y57G11C.487"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045015 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           192398..192418
FT                   /locus_tag="Y57G11C.488"
FT                   /standard_name="Y57G11C.488"
FT                   /product="Hypothetical RNA transcript Y57G11C.488"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045848 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242771..242791
FT                   /locus_tag="Y57G11C.489"
FT                   /standard_name="Y57G11C.489"
FT                   /product="Hypothetical RNA transcript Y57G11C.489"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049033 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(262169..262189)
FT                   /locus_tag="Y57G11C.490"
FT                   /standard_name="Y57G11C.490"
FT                   /product="Hypothetical RNA transcript Y57G11C.490"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049824 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(270791..270811)
FT                   /locus_tag="Y57G11C.491"
FT                   /standard_name="Y57G11C.491"
FT                   /product="Hypothetical RNA transcript Y57G11C.491"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047955 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           17413..17433
FT                   /locus_tag="Y57G11C.492"
FT                   /standard_name="Y57G11C.492"
FT                   /product="Hypothetical RNA transcript Y57G11C.492"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF049001 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58299..58319
FT                   /locus_tag="Y57G11C.493"
FT                   /standard_name="Y57G11C.493"
FT                   /product="Hypothetical RNA transcript Y57G11C.493"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046419 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(84691..84711)
FT                   /locus_tag="Y57G11C.494"
FT                   /standard_name="Y57G11C.494"
FT                   /product="Hypothetical RNA transcript Y57G11C.494"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF048494 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(279779..279799)
FT                   /locus_tag="Y57G11C.495"
FT                   /standard_name="Y57G11C.495"
FT                   /product="Hypothetical RNA transcript Y57G11C.495"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF045174 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           261666..261686
FT                   /locus_tag="Y57G11C.496"
FT                   /standard_name="Y57G11C.496"
FT                   /product="Hypothetical RNA transcript Y57G11C.496"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047610 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(25766..25786)
FT                   /locus_tag="Y57G11C.497"
FT                   /standard_name="Y57G11C.497"
FT                   /product="Hypothetical RNA transcript Y57G11C.497"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF047611 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           73079..73099
FT                   /locus_tag="Y57G11C.498"
FT                   /standard_name="Y57G11C.498"
FT                   /product="Hypothetical RNA transcript Y57G11C.498"
FT                   /note="21U RNA gene"
FT                   /note="cDNA EST EF046266 comes from this gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(279243..279263)
FT                   /locus_tag="Y57G11C.500"
FT                   /standard_name="Y57G11C.500"
FT                   /product="Hypothetical RNA transcript Y57G11C.500"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           302319..302339
FT                   /locus_tag="Y57G11C.501"
FT                   /standard_name="Y57G11C.501"
FT                   /product="Hypothetical RNA transcript Y57G11C.501"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           88373..88393
FT                   /locus_tag="Y57G11C.502"
FT                   /standard_name="Y57G11C.502"
FT                   /product="Hypothetical RNA transcript Y57G11C.502"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(80579..80599)
FT                   /locus_tag="Y57G11C.503"
FT                   /standard_name="Y57G11C.503"
FT                   /product="Hypothetical RNA transcript Y57G11C.503"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270297..270317
FT                   /locus_tag="Y57G11C.504"
FT                   /standard_name="Y57G11C.504"
FT                   /product="Hypothetical RNA transcript Y57G11C.504"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(91161..91181)
FT                   /locus_tag="Y57G11C.505"
FT                   /standard_name="Y57G11C.505"
FT                   /product="Hypothetical RNA transcript Y57G11C.505"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           235951..235971
FT                   /locus_tag="Y57G11C.506"
FT                   /standard_name="Y57G11C.506"
FT                   /product="Hypothetical RNA transcript Y57G11C.506"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47730..47750)
FT                   /locus_tag="Y57G11C.507"
FT                   /standard_name="Y57G11C.507"
FT                   /product="Hypothetical RNA transcript Y57G11C.507"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           246467..246487
FT                   /locus_tag="Y57G11C.508"
FT                   /standard_name="Y57G11C.508"
FT                   /product="Hypothetical RNA transcript Y57G11C.508"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(278320..278340)
FT                   /locus_tag="Y57G11C.509"
FT                   /standard_name="Y57G11C.509"
FT                   /product="Hypothetical RNA transcript Y57G11C.509"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           239928..239948
FT                   /locus_tag="Y57G11C.510"
FT                   /standard_name="Y57G11C.510"
FT                   /product="Hypothetical RNA transcript Y57G11C.510"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           115770..115790
FT                   /locus_tag="Y57G11C.511"
FT                   /standard_name="Y57G11C.511"
FT                   /product="Hypothetical RNA transcript Y57G11C.511"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(257750..257770)
FT                   /locus_tag="Y57G11C.512"
FT                   /standard_name="Y57G11C.512"
FT                   /product="Hypothetical RNA transcript Y57G11C.512"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           262086..262106
FT                   /locus_tag="Y57G11C.513"
FT                   /standard_name="Y57G11C.513"
FT                   /product="Hypothetical RNA transcript Y57G11C.513"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(239237..239257)
FT                   /locus_tag="Y57G11C.514"
FT                   /standard_name="Y57G11C.514"
FT                   /product="Hypothetical RNA transcript Y57G11C.514"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(124908..124928)
FT                   /locus_tag="Y57G11C.515"
FT                   /standard_name="Y57G11C.515"
FT                   /product="Hypothetical RNA transcript Y57G11C.515"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           292857..292877
FT                   /locus_tag="Y57G11C.516"
FT                   /standard_name="Y57G11C.516"
FT                   /product="Hypothetical RNA transcript Y57G11C.516"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(114939..114959)
FT                   /locus_tag="Y57G11C.517"
FT                   /standard_name="Y57G11C.517"
FT                   /product="Hypothetical RNA transcript Y57G11C.517"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96102..96122
FT                   /locus_tag="Y57G11C.518"
FT                   /standard_name="Y57G11C.518"
FT                   /product="Hypothetical RNA transcript Y57G11C.518"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           97047..97067
FT                   /locus_tag="Y57G11C.519"
FT                   /standard_name="Y57G11C.519"
FT                   /product="Hypothetical RNA transcript Y57G11C.519"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(124358..124378)
FT                   /locus_tag="Y57G11C.520"
FT                   /standard_name="Y57G11C.520"
FT                   /product="Hypothetical RNA transcript Y57G11C.520"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119894..119914
FT                   /locus_tag="Y57G11C.521"
FT                   /standard_name="Y57G11C.521"
FT                   /product="Hypothetical RNA transcript Y57G11C.521"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(37285..37305)
FT                   /locus_tag="Y57G11C.522"
FT                   /standard_name="Y57G11C.522"
FT                   /product="Hypothetical RNA transcript Y57G11C.522"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           89321..89341
FT                   /locus_tag="Y57G11C.523"
FT                   /standard_name="Y57G11C.523"
FT                   /product="Hypothetical RNA transcript Y57G11C.523"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29714..29734)
FT                   /locus_tag="Y57G11C.524"
FT                   /standard_name="Y57G11C.524"
FT                   /product="Hypothetical RNA transcript Y57G11C.524"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           63407..63427
FT                   /locus_tag="Y57G11C.525"
FT                   /standard_name="Y57G11C.525"
FT                   /product="Hypothetical RNA transcript Y57G11C.525"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(34851..34871)
FT                   /locus_tag="Y57G11C.526"
FT                   /standard_name="Y57G11C.526"
FT                   /product="Hypothetical RNA transcript Y57G11C.526"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(58458..58478)
FT                   /locus_tag="Y57G11C.527"
FT                   /standard_name="Y57G11C.527"
FT                   /product="Hypothetical RNA transcript Y57G11C.527"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           216100..216120
FT                   /locus_tag="Y57G11C.528"
FT                   /standard_name="Y57G11C.528"
FT                   /product="Hypothetical RNA transcript Y57G11C.528"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77483..77503)
FT                   /locus_tag="Y57G11C.529"
FT                   /standard_name="Y57G11C.529"
FT                   /product="Hypothetical RNA transcript Y57G11C.529"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214411..214431)
FT                   /locus_tag="Y57G11C.530"
FT                   /standard_name="Y57G11C.530"
FT                   /product="Hypothetical RNA transcript Y57G11C.530"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(59296..59316)
FT                   /locus_tag="Y57G11C.531"
FT                   /standard_name="Y57G11C.531"
FT                   /product="Hypothetical RNA transcript Y57G11C.531"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           218597..218617
FT                   /locus_tag="Y57G11C.532"
FT                   /standard_name="Y57G11C.532"
FT                   /product="Hypothetical RNA transcript Y57G11C.532"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233305..233325
FT                   /locus_tag="Y57G11C.533"
FT                   /standard_name="Y57G11C.533"
FT                   /product="Hypothetical RNA transcript Y57G11C.533"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12376..12396
FT                   /locus_tag="Y57G11C.534"
FT                   /standard_name="Y57G11C.534"
FT                   /product="Hypothetical RNA transcript Y57G11C.534"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(114307..114327)
FT                   /locus_tag="Y57G11C.535"
FT                   /standard_name="Y57G11C.535"
FT                   /product="Hypothetical RNA transcript Y57G11C.535"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(304183..304203)
FT                   /locus_tag="Y57G11C.536"
FT                   /standard_name="Y57G11C.536"
FT                   /product="Hypothetical RNA transcript Y57G11C.536"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           22751..22771
FT                   /locus_tag="Y57G11C.537"
FT                   /standard_name="Y57G11C.537"
FT                   /product="Hypothetical RNA transcript Y57G11C.537"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(6369..6389)
FT                   /locus_tag="Y57G11C.538"
FT                   /standard_name="Y57G11C.538"
FT                   /product="Hypothetical RNA transcript Y57G11C.538"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(23249..23269)
FT                   /locus_tag="Y57G11C.539"
FT                   /standard_name="Y57G11C.539"
FT                   /product="Hypothetical RNA transcript Y57G11C.539"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(115064..115084)
FT                   /locus_tag="Y57G11C.540"
FT                   /standard_name="Y57G11C.540"
FT                   /product="Hypothetical RNA transcript Y57G11C.540"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           2992..3012
FT                   /locus_tag="Y57G11C.541"
FT                   /standard_name="Y57G11C.541"
FT                   /product="Hypothetical RNA transcript Y57G11C.541"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264308..264328
FT                   /locus_tag="Y57G11C.542"
FT                   /standard_name="Y57G11C.542"
FT                   /product="Hypothetical RNA transcript Y57G11C.542"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(13322..13342)
FT                   /locus_tag="Y57G11C.543"
FT                   /standard_name="Y57G11C.543"
FT                   /product="Hypothetical RNA transcript Y57G11C.543"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(297468..297488)
FT                   /locus_tag="Y57G11C.544"
FT                   /standard_name="Y57G11C.544"
FT                   /product="Hypothetical RNA transcript Y57G11C.544"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(254173..254193)
FT                   /locus_tag="Y57G11C.545"
FT                   /standard_name="Y57G11C.545"
FT                   /product="Hypothetical RNA transcript Y57G11C.545"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(268741..268761)
FT                   /locus_tag="Y57G11C.546"
FT                   /standard_name="Y57G11C.546"
FT                   /product="Hypothetical RNA transcript Y57G11C.546"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(216554..216574)
FT                   /locus_tag="Y57G11C.547"
FT                   /standard_name="Y57G11C.547"
FT                   /product="Hypothetical RNA transcript Y57G11C.547"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(25598..25618)
FT                   /locus_tag="Y57G11C.548"
FT                   /standard_name="Y57G11C.548"
FT                   /product="Hypothetical RNA transcript Y57G11C.548"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(252339..252359)
FT                   /locus_tag="Y57G11C.549"
FT                   /standard_name="Y57G11C.549"
FT                   /product="Hypothetical RNA transcript Y57G11C.549"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           284004..284024
FT                   /locus_tag="Y57G11C.550"
FT                   /standard_name="Y57G11C.550"
FT                   /product="Hypothetical RNA transcript Y57G11C.550"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           39931..39951
FT                   /locus_tag="Y57G11C.551"
FT                   /standard_name="Y57G11C.551"
FT                   /product="Hypothetical RNA transcript Y57G11C.551"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           39301..39321
FT                   /locus_tag="Y57G11C.552"
FT                   /standard_name="Y57G11C.552"
FT                   /product="Hypothetical RNA transcript Y57G11C.552"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107742..107762
FT                   /locus_tag="Y57G11C.553"
FT                   /standard_name="Y57G11C.553"
FT                   /product="Hypothetical RNA transcript Y57G11C.553"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           180315..180335
FT                   /locus_tag="Y57G11C.554"
FT                   /standard_name="Y57G11C.554"
FT                   /product="Hypothetical RNA transcript Y57G11C.554"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281485..281505
FT                   /locus_tag="Y57G11C.555"
FT                   /standard_name="Y57G11C.555"
FT                   /product="Hypothetical RNA transcript Y57G11C.555"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           31110..31130
FT                   /locus_tag="Y57G11C.556"
FT                   /standard_name="Y57G11C.556"
FT                   /product="Hypothetical RNA transcript Y57G11C.556"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(113611..113631)
FT                   /locus_tag="Y57G11C.557"
FT                   /standard_name="Y57G11C.557"
FT                   /product="Hypothetical RNA transcript Y57G11C.557"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(98086..98106)
FT                   /locus_tag="Y57G11C.558"
FT                   /standard_name="Y57G11C.558"
FT                   /product="Hypothetical RNA transcript Y57G11C.558"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(164456..164476)
FT                   /locus_tag="Y57G11C.559"
FT                   /standard_name="Y57G11C.559"
FT                   /product="Hypothetical RNA transcript Y57G11C.559"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(261833..261853)
FT                   /locus_tag="Y57G11C.560"
FT                   /standard_name="Y57G11C.560"
FT                   /product="Hypothetical RNA transcript Y57G11C.560"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96817..96837
FT                   /locus_tag="Y57G11C.561"
FT                   /standard_name="Y57G11C.561"
FT                   /product="Hypothetical RNA transcript Y57G11C.561"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           179288..179308
FT                   /locus_tag="Y57G11C.562"
FT                   /standard_name="Y57G11C.562"
FT                   /product="Hypothetical RNA transcript Y57G11C.562"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(120104..120124)
FT                   /locus_tag="Y57G11C.563"
FT                   /standard_name="Y57G11C.563"
FT                   /product="Hypothetical RNA transcript Y57G11C.563"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           211311..211331
FT                   /locus_tag="Y57G11C.564"
FT                   /standard_name="Y57G11C.564"
FT                   /product="Hypothetical RNA transcript Y57G11C.564"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(120683..120703)
FT                   /locus_tag="Y57G11C.565"
FT                   /standard_name="Y57G11C.565"
FT                   /product="Hypothetical RNA transcript Y57G11C.565"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58672..58692
FT                   /locus_tag="Y57G11C.566"
FT                   /standard_name="Y57G11C.566"
FT                   /product="Hypothetical RNA transcript Y57G11C.566"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(80913..80933)
FT                   /locus_tag="Y57G11C.567"
FT                   /standard_name="Y57G11C.567"
FT                   /product="Hypothetical RNA transcript Y57G11C.567"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29386..29406)
FT                   /locus_tag="Y57G11C.568"
FT                   /standard_name="Y57G11C.568"
FT                   /product="Hypothetical RNA transcript Y57G11C.568"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214414..214434)
FT                   /locus_tag="Y57G11C.569"
FT                   /standard_name="Y57G11C.569"
FT                   /product="Hypothetical RNA transcript Y57G11C.569"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(277394..277414)
FT                   /locus_tag="Y57G11C.570"
FT                   /standard_name="Y57G11C.570"
FT                   /product="Hypothetical RNA transcript Y57G11C.570"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233307..233327
FT                   /locus_tag="Y57G11C.571"
FT                   /standard_name="Y57G11C.571"
FT                   /product="Hypothetical RNA transcript Y57G11C.571"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           224681..224701
FT                   /locus_tag="Y57G11C.572"
FT                   /standard_name="Y57G11C.572"
FT                   /product="Hypothetical RNA transcript Y57G11C.572"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(32935..32955)
FT                   /locus_tag="Y57G11C.573"
FT                   /standard_name="Y57G11C.573"
FT                   /product="Hypothetical RNA transcript Y57G11C.573"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(65764..65784)
FT                   /locus_tag="Y57G11C.574"
FT                   /standard_name="Y57G11C.574"
FT                   /product="Hypothetical RNA transcript Y57G11C.574"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(108653..108673)
FT                   /locus_tag="Y57G11C.575"
FT                   /standard_name="Y57G11C.575"
FT                   /product="Hypothetical RNA transcript Y57G11C.575"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(222519..222539)
FT                   /locus_tag="Y57G11C.576"
FT                   /standard_name="Y57G11C.576"
FT                   /product="Hypothetical RNA transcript Y57G11C.576"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           43682..43702
FT                   /locus_tag="Y57G11C.577"
FT                   /standard_name="Y57G11C.577"
FT                   /product="Hypothetical RNA transcript Y57G11C.577"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(22474..22494)
FT                   /locus_tag="Y57G11C.578"
FT                   /standard_name="Y57G11C.578"
FT                   /product="Hypothetical RNA transcript Y57G11C.578"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(97789..97809)
FT                   /locus_tag="Y57G11C.579"
FT                   /standard_name="Y57G11C.579"
FT                   /product="Hypothetical RNA transcript Y57G11C.579"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270348..270368
FT                   /locus_tag="Y57G11C.580"
FT                   /standard_name="Y57G11C.580"
FT                   /product="Hypothetical RNA transcript Y57G11C.580"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           251445..251465
FT                   /locus_tag="Y57G11C.581"
FT                   /standard_name="Y57G11C.581"
FT                   /product="Hypothetical RNA transcript Y57G11C.581"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           241708..241728
FT                   /locus_tag="Y57G11C.582"
FT                   /standard_name="Y57G11C.582"
FT                   /product="Hypothetical RNA transcript Y57G11C.582"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(234907..234927)
FT                   /locus_tag="Y57G11C.583"
FT                   /standard_name="Y57G11C.583"
FT                   /product="Hypothetical RNA transcript Y57G11C.583"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(255391..255411)
FT                   /locus_tag="Y57G11C.584"
FT                   /standard_name="Y57G11C.584"
FT                   /product="Hypothetical RNA transcript Y57G11C.584"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           71740..71760
FT                   /locus_tag="Y57G11C.585"
FT                   /standard_name="Y57G11C.585"
FT                   /product="Hypothetical RNA transcript Y57G11C.585"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(124905..124925)
FT                   /locus_tag="Y57G11C.586"
FT                   /standard_name="Y57G11C.586"
FT                   /product="Hypothetical RNA transcript Y57G11C.586"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247141..247161
FT                   /locus_tag="Y57G11C.587"
FT                   /standard_name="Y57G11C.587"
FT                   /product="Hypothetical RNA transcript Y57G11C.587"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(305741..305761)
FT                   /locus_tag="Y57G11C.588"
FT                   /standard_name="Y57G11C.588"
FT                   /product="Hypothetical RNA transcript Y57G11C.588"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107670..107690
FT                   /locus_tag="Y57G11C.589"
FT                   /standard_name="Y57G11C.589"
FT                   /product="Hypothetical RNA transcript Y57G11C.589"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(254915..254935)
FT                   /locus_tag="Y57G11C.590"
FT                   /standard_name="Y57G11C.590"
FT                   /product="Hypothetical RNA transcript Y57G11C.590"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(65283..65303)
FT                   /locus_tag="Y57G11C.591"
FT                   /standard_name="Y57G11C.591"
FT                   /product="Hypothetical RNA transcript Y57G11C.591"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           100492..100512
FT                   /locus_tag="Y57G11C.592"
FT                   /standard_name="Y57G11C.592"
FT                   /product="Hypothetical RNA transcript Y57G11C.592"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12341..12361
FT                   /locus_tag="Y57G11C.593"
FT                   /standard_name="Y57G11C.593"
FT                   /product="Hypothetical RNA transcript Y57G11C.593"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250289..250309)
FT                   /locus_tag="Y57G11C.594"
FT                   /standard_name="Y57G11C.594"
FT                   /product="Hypothetical RNA transcript Y57G11C.594"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           17265..17285
FT                   /locus_tag="Y57G11C.595"
FT                   /standard_name="Y57G11C.595"
FT                   /product="Hypothetical RNA transcript Y57G11C.595"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           44252..44272
FT                   /locus_tag="Y57G11C.596"
FT                   /standard_name="Y57G11C.596"
FT                   /product="Hypothetical RNA transcript Y57G11C.596"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           15297..15317
FT                   /locus_tag="Y57G11C.597"
FT                   /standard_name="Y57G11C.597"
FT                   /product="Hypothetical RNA transcript Y57G11C.597"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           104167..104187
FT                   /locus_tag="Y57G11C.598"
FT                   /standard_name="Y57G11C.598"
FT                   /product="Hypothetical RNA transcript Y57G11C.598"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270296..270316
FT                   /locus_tag="Y57G11C.599"
FT                   /standard_name="Y57G11C.599"
FT                   /product="Hypothetical RNA transcript Y57G11C.599"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(174860..174880)
FT                   /locus_tag="Y57G11C.600"
FT                   /standard_name="Y57G11C.600"
FT                   /product="Hypothetical RNA transcript Y57G11C.600"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232330..232350)
FT                   /locus_tag="Y57G11C.601"
FT                   /standard_name="Y57G11C.601"
FT                   /product="Hypothetical RNA transcript Y57G11C.601"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(75866..75886)
FT                   /locus_tag="Y57G11C.602"
FT                   /standard_name="Y57G11C.602"
FT                   /product="Hypothetical RNA transcript Y57G11C.602"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           26678..26698
FT                   /locus_tag="Y57G11C.603"
FT                   /standard_name="Y57G11C.603"
FT                   /product="Hypothetical RNA transcript Y57G11C.603"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(200727..200747)
FT                   /locus_tag="Y57G11C.604"
FT                   /standard_name="Y57G11C.604"
FT                   /product="Hypothetical RNA transcript Y57G11C.604"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(226476..226496)
FT                   /locus_tag="Y57G11C.605"
FT                   /standard_name="Y57G11C.605"
FT                   /product="Hypothetical RNA transcript Y57G11C.605"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(284882..284902)
FT                   /locus_tag="Y57G11C.606"
FT                   /standard_name="Y57G11C.606"
FT                   /product="Hypothetical RNA transcript Y57G11C.606"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(218445..218465)
FT                   /locus_tag="Y57G11C.607"
FT                   /standard_name="Y57G11C.607"
FT                   /product="Hypothetical RNA transcript Y57G11C.607"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           303693..303713
FT                   /locus_tag="Y57G11C.608"
FT                   /standard_name="Y57G11C.608"
FT                   /product="Hypothetical RNA transcript Y57G11C.608"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11411..11431
FT                   /locus_tag="Y57G11C.609"
FT                   /standard_name="Y57G11C.609"
FT                   /product="Hypothetical RNA transcript Y57G11C.609"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(48090..48110)
FT                   /locus_tag="Y57G11C.610"
FT                   /standard_name="Y57G11C.610"
FT                   /product="Hypothetical RNA transcript Y57G11C.610"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(49312..49332)
FT                   /locus_tag="Y57G11C.611"
FT                   /standard_name="Y57G11C.611"
FT                   /product="Hypothetical RNA transcript Y57G11C.611"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(69216..69236)
FT                   /locus_tag="Y57G11C.612"
FT                   /standard_name="Y57G11C.612"
FT                   /product="Hypothetical RNA transcript Y57G11C.612"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(312806..312826)
FT                   /locus_tag="Y57G11C.613"
FT                   /standard_name="Y57G11C.613"
FT                   /product="Hypothetical RNA transcript Y57G11C.613"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           211818..211838
FT                   /locus_tag="Y57G11C.614"
FT                   /standard_name="Y57G11C.614"
FT                   /product="Hypothetical RNA transcript Y57G11C.614"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107250..107270
FT                   /locus_tag="Y57G11C.615"
FT                   /standard_name="Y57G11C.615"
FT                   /product="Hypothetical RNA transcript Y57G11C.615"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96105..96125
FT                   /locus_tag="Y57G11C.616"
FT                   /standard_name="Y57G11C.616"
FT                   /product="Hypothetical RNA transcript Y57G11C.616"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50412..50432
FT                   /locus_tag="Y57G11C.617"
FT                   /standard_name="Y57G11C.617"
FT                   /product="Hypothetical RNA transcript Y57G11C.617"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(237236..237256)
FT                   /locus_tag="Y57G11C.618"
FT                   /standard_name="Y57G11C.618"
FT                   /product="Hypothetical RNA transcript Y57G11C.618"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           192157..192177
FT                   /locus_tag="Y57G11C.619"
FT                   /standard_name="Y57G11C.619"
FT                   /product="Hypothetical RNA transcript Y57G11C.619"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(244522..244542)
FT                   /locus_tag="Y57G11C.620"
FT                   /standard_name="Y57G11C.620"
FT                   /product="Hypothetical RNA transcript Y57G11C.620"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(236540..236560)
FT                   /locus_tag="Y57G11C.621"
FT                   /standard_name="Y57G11C.621"
FT                   /product="Hypothetical RNA transcript Y57G11C.621"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(64803..64823)
FT                   /locus_tag="Y57G11C.622"
FT                   /standard_name="Y57G11C.622"
FT                   /product="Hypothetical RNA transcript Y57G11C.622"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247539..247559
FT                   /locus_tag="Y57G11C.623"
FT                   /standard_name="Y57G11C.623"
FT                   /product="Hypothetical RNA transcript Y57G11C.623"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9940..9960)
FT                   /locus_tag="Y57G11C.624"
FT                   /standard_name="Y57G11C.624"
FT                   /product="Hypothetical RNA transcript Y57G11C.624"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(95288..95308)
FT                   /locus_tag="Y57G11C.625"
FT                   /standard_name="Y57G11C.625"
FT                   /product="Hypothetical RNA transcript Y57G11C.625"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           285879..285899
FT                   /locus_tag="Y57G11C.626"
FT                   /standard_name="Y57G11C.626"
FT                   /product="Hypothetical RNA transcript Y57G11C.626"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           208316..208336
FT                   /locus_tag="Y57G11C.627"
FT                   /standard_name="Y57G11C.627"
FT                   /product="Hypothetical RNA transcript Y57G11C.627"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(92458..92478)
FT                   /locus_tag="Y57G11C.628"
FT                   /standard_name="Y57G11C.628"
FT                   /product="Hypothetical RNA transcript Y57G11C.628"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           102345..102365
FT                   /locus_tag="Y57G11C.629"
FT                   /standard_name="Y57G11C.629"
FT                   /product="Hypothetical RNA transcript Y57G11C.629"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(69217..69237)
FT                   /locus_tag="Y57G11C.630"
FT                   /standard_name="Y57G11C.630"
FT                   /product="Hypothetical RNA transcript Y57G11C.630"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(217984..218004)
FT                   /locus_tag="Y57G11C.631"
FT                   /standard_name="Y57G11C.631"
FT                   /product="Hypothetical RNA transcript Y57G11C.631"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           100450..100470
FT                   /locus_tag="Y57G11C.632"
FT                   /standard_name="Y57G11C.632"
FT                   /product="Hypothetical RNA transcript Y57G11C.632"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(80002..80022)
FT                   /locus_tag="Y57G11C.633"
FT                   /standard_name="Y57G11C.633"
FT                   /product="Hypothetical RNA transcript Y57G11C.633"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(225643..225663)
FT                   /locus_tag="Y57G11C.634"
FT                   /standard_name="Y57G11C.634"
FT                   /product="Hypothetical RNA transcript Y57G11C.634"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(49311..49331)
FT                   /locus_tag="Y57G11C.635"
FT                   /standard_name="Y57G11C.635"
FT                   /product="Hypothetical RNA transcript Y57G11C.635"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           241642..241662
FT                   /locus_tag="Y57G11C.636"
FT                   /standard_name="Y57G11C.636"
FT                   /product="Hypothetical RNA transcript Y57G11C.636"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96104..96124
FT                   /locus_tag="Y57G11C.637"
FT                   /standard_name="Y57G11C.637"
FT                   /product="Hypothetical RNA transcript Y57G11C.637"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           303692..303712
FT                   /locus_tag="Y57G11C.638"
FT                   /standard_name="Y57G11C.638"
FT                   /product="Hypothetical RNA transcript Y57G11C.638"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(28183..28203)
FT                   /locus_tag="Y57G11C.639"
FT                   /standard_name="Y57G11C.639"
FT                   /product="Hypothetical RNA transcript Y57G11C.639"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(42841..42861)
FT                   /locus_tag="Y57G11C.640"
FT                   /standard_name="Y57G11C.640"
FT                   /product="Hypothetical RNA transcript Y57G11C.640"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(239236..239256)
FT                   /locus_tag="Y57G11C.641"
FT                   /standard_name="Y57G11C.641"
FT                   /product="Hypothetical RNA transcript Y57G11C.641"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(220864..220884)
FT                   /locus_tag="Y57G11C.642"
FT                   /standard_name="Y57G11C.642"
FT                   /product="Hypothetical RNA transcript Y57G11C.642"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(86406..86426)
FT                   /locus_tag="Y57G11C.643"
FT                   /standard_name="Y57G11C.643"
FT                   /product="Hypothetical RNA transcript Y57G11C.643"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           181481..181501
FT                   /locus_tag="Y57G11C.644"
FT                   /standard_name="Y57G11C.644"
FT                   /product="Hypothetical RNA transcript Y57G11C.644"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           262796..262816
FT                   /locus_tag="Y57G11C.645"
FT                   /standard_name="Y57G11C.645"
FT                   /product="Hypothetical RNA transcript Y57G11C.645"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           9602..9622
FT                   /locus_tag="Y57G11C.646"
FT                   /standard_name="Y57G11C.646"
FT                   /product="Hypothetical RNA transcript Y57G11C.646"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(91329..91349)
FT                   /locus_tag="Y57G11C.647"
FT                   /standard_name="Y57G11C.647"
FT                   /product="Hypothetical RNA transcript Y57G11C.647"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           234002..234022
FT                   /locus_tag="Y57G11C.648"
FT                   /standard_name="Y57G11C.648"
FT                   /product="Hypothetical RNA transcript Y57G11C.648"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58091..58111
FT                   /locus_tag="Y57G11C.649"
FT                   /standard_name="Y57G11C.649"
FT                   /product="Hypothetical RNA transcript Y57G11C.649"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(286434..286454)
FT                   /locus_tag="Y57G11C.650"
FT                   /standard_name="Y57G11C.650"
FT                   /product="Hypothetical RNA transcript Y57G11C.650"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           14190..14210
FT                   /locus_tag="Y57G11C.651"
FT                   /standard_name="Y57G11C.651"
FT                   /product="Hypothetical RNA transcript Y57G11C.651"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           115095..115115
FT                   /locus_tag="Y57G11C.652"
FT                   /standard_name="Y57G11C.652"
FT                   /product="Hypothetical RNA transcript Y57G11C.652"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(167347..167367)
FT                   /locus_tag="Y57G11C.653"
FT                   /standard_name="Y57G11C.653"
FT                   /product="Hypothetical RNA transcript Y57G11C.653"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           93248..93268
FT                   /locus_tag="Y57G11C.654"
FT                   /standard_name="Y57G11C.654"
FT                   /product="Hypothetical RNA transcript Y57G11C.654"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           236208..236228
FT                   /locus_tag="Y57G11C.655"
FT                   /standard_name="Y57G11C.655"
FT                   /product="Hypothetical RNA transcript Y57G11C.655"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(58117..58137)
FT                   /locus_tag="Y57G11C.656"
FT                   /standard_name="Y57G11C.656"
FT                   /product="Hypothetical RNA transcript Y57G11C.656"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(58820..58840)
FT                   /locus_tag="Y57G11C.657"
FT                   /standard_name="Y57G11C.657"
FT                   /product="Hypothetical RNA transcript Y57G11C.657"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           265749..265769
FT                   /locus_tag="Y57G11C.658"
FT                   /standard_name="Y57G11C.658"
FT                   /product="Hypothetical RNA transcript Y57G11C.658"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           13584..13604
FT                   /locus_tag="Y57G11C.659"
FT                   /standard_name="Y57G11C.659"
FT                   /product="Hypothetical RNA transcript Y57G11C.659"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           297518..297538
FT                   /locus_tag="Y57G11C.660"
FT                   /standard_name="Y57G11C.660"
FT                   /product="Hypothetical RNA transcript Y57G11C.660"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264937..264957
FT                   /locus_tag="Y57G11C.661"
FT                   /standard_name="Y57G11C.661"
FT                   /product="Hypothetical RNA transcript Y57G11C.661"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(10195..10215)
FT                   /locus_tag="Y57G11C.662"
FT                   /standard_name="Y57G11C.662"
FT                   /product="Hypothetical RNA transcript Y57G11C.662"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(46721..46741)
FT                   /locus_tag="Y57G11C.663"
FT                   /standard_name="Y57G11C.663"
FT                   /product="Hypothetical RNA transcript Y57G11C.663"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           282129..282149
FT                   /locus_tag="Y57G11C.664"
FT                   /standard_name="Y57G11C.664"
FT                   /product="Hypothetical RNA transcript Y57G11C.664"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(298011..298031)
FT                   /locus_tag="Y57G11C.665"
FT                   /standard_name="Y57G11C.665"
FT                   /product="Hypothetical RNA transcript Y57G11C.665"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(178392..178412)
FT                   /locus_tag="Y57G11C.666"
FT                   /standard_name="Y57G11C.666"
FT                   /product="Hypothetical RNA transcript Y57G11C.666"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           194033..194053
FT                   /locus_tag="Y57G11C.667"
FT                   /standard_name="Y57G11C.667"
FT                   /product="Hypothetical RNA transcript Y57G11C.667"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           8376..8396
FT                   /locus_tag="Y57G11C.668"
FT                   /standard_name="Y57G11C.668"
FT                   /product="Hypothetical RNA transcript Y57G11C.668"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(56473..56493)
FT                   /locus_tag="Y57G11C.669"
FT                   /standard_name="Y57G11C.669"
FT                   /product="Hypothetical RNA transcript Y57G11C.669"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(210745..210765)
FT                   /locus_tag="Y57G11C.670"
FT                   /standard_name="Y57G11C.670"
FT                   /product="Hypothetical RNA transcript Y57G11C.670"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           45675..45695
FT                   /locus_tag="Y57G11C.671"
FT                   /standard_name="Y57G11C.671"
FT                   /product="Hypothetical RNA transcript Y57G11C.671"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(247791..247811)
FT                   /locus_tag="Y57G11C.672"
FT                   /standard_name="Y57G11C.672"
FT                   /product="Hypothetical RNA transcript Y57G11C.672"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(252763..252783)
FT                   /locus_tag="Y57G11C.673"
FT                   /standard_name="Y57G11C.673"
FT                   /product="Hypothetical RNA transcript Y57G11C.673"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(168864..168884)
FT                   /locus_tag="Y57G11C.674"
FT                   /standard_name="Y57G11C.674"
FT                   /product="Hypothetical RNA transcript Y57G11C.674"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50415..50435
FT                   /locus_tag="Y57G11C.675"
FT                   /standard_name="Y57G11C.675"
FT                   /product="Hypothetical RNA transcript Y57G11C.675"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(110904..110924)
FT                   /locus_tag="Y57G11C.676"
FT                   /standard_name="Y57G11C.676"
FT                   /product="Hypothetical RNA transcript Y57G11C.676"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50143..50163
FT                   /locus_tag="Y57G11C.677"
FT                   /standard_name="Y57G11C.677"
FT                   /product="Hypothetical RNA transcript Y57G11C.677"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(78854..78874)
FT                   /locus_tag="Y57G11C.678"
FT                   /standard_name="Y57G11C.678"
FT                   /product="Hypothetical RNA transcript Y57G11C.678"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30924..30944
FT                   /locus_tag="Y57G11C.679"
FT                   /standard_name="Y57G11C.679"
FT                   /product="Hypothetical RNA transcript Y57G11C.679"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           57917..57937
FT                   /locus_tag="Y57G11C.680"
FT                   /standard_name="Y57G11C.680"
FT                   /product="Hypothetical RNA transcript Y57G11C.680"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           5670..5690
FT                   /locus_tag="Y57G11C.681"
FT                   /standard_name="Y57G11C.681"
FT                   /product="Hypothetical RNA transcript Y57G11C.681"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           220237..220257
FT                   /locus_tag="Y57G11C.682"
FT                   /standard_name="Y57G11C.682"
FT                   /product="Hypothetical RNA transcript Y57G11C.682"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119824..119844
FT                   /locus_tag="Y57G11C.683"
FT                   /standard_name="Y57G11C.683"
FT                   /product="Hypothetical RNA transcript Y57G11C.683"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           235855..235875
FT                   /locus_tag="Y57G11C.684"
FT                   /standard_name="Y57G11C.684"
FT                   /product="Hypothetical RNA transcript Y57G11C.684"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(13065..13085)
FT                   /locus_tag="Y57G11C.685"
FT                   /standard_name="Y57G11C.685"
FT                   /product="Hypothetical RNA transcript Y57G11C.685"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(177830..177850)
FT                   /locus_tag="Y57G11C.686"
FT                   /standard_name="Y57G11C.686"
FT                   /product="Hypothetical RNA transcript Y57G11C.686"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(59006..59026)
FT                   /locus_tag="Y57G11C.687"
FT                   /standard_name="Y57G11C.687"
FT                   /product="Hypothetical RNA transcript Y57G11C.687"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           59193..59213
FT                   /locus_tag="Y57G11C.688"
FT                   /standard_name="Y57G11C.688"
FT                   /product="Hypothetical RNA transcript Y57G11C.688"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(252272..252292)
FT                   /locus_tag="Y57G11C.689"
FT                   /standard_name="Y57G11C.689"
FT                   /product="Hypothetical RNA transcript Y57G11C.689"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(43229..43249)
FT                   /locus_tag="Y57G11C.690"
FT                   /standard_name="Y57G11C.690"
FT                   /product="Hypothetical RNA transcript Y57G11C.690"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(286374..286394)
FT                   /locus_tag="Y57G11C.691"
FT                   /standard_name="Y57G11C.691"
FT                   /product="Hypothetical RNA transcript Y57G11C.691"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           181140..181160
FT                   /locus_tag="Y57G11C.692"
FT                   /standard_name="Y57G11C.692"
FT                   /product="Hypothetical RNA transcript Y57G11C.692"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           88106..88126
FT                   /locus_tag="Y57G11C.693"
FT                   /standard_name="Y57G11C.693"
FT                   /product="Hypothetical RNA transcript Y57G11C.693"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           123931..123951
FT                   /locus_tag="Y57G11C.694"
FT                   /standard_name="Y57G11C.694"
FT                   /product="Hypothetical RNA transcript Y57G11C.694"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           245734..245754
FT                   /locus_tag="Y57G11C.695"
FT                   /standard_name="Y57G11C.695"
FT                   /product="Hypothetical RNA transcript Y57G11C.695"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(230167..230187)
FT                   /locus_tag="Y57G11C.696"
FT                   /standard_name="Y57G11C.696"
FT                   /product="Hypothetical RNA transcript Y57G11C.696"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           88107..88127
FT                   /locus_tag="Y57G11C.697"
FT                   /standard_name="Y57G11C.697"
FT                   /product="Hypothetical RNA transcript Y57G11C.697"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           246564..246584
FT                   /locus_tag="Y57G11C.698"
FT                   /standard_name="Y57G11C.698"
FT                   /product="Hypothetical RNA transcript Y57G11C.698"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           272127..272147
FT                   /locus_tag="Y57G11C.699"
FT                   /standard_name="Y57G11C.699"
FT                   /product="Hypothetical RNA transcript Y57G11C.699"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(41639..41659)
FT                   /locus_tag="Y57G11C.700"
FT                   /standard_name="Y57G11C.700"
FT                   /product="Hypothetical RNA transcript Y57G11C.700"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29166..29186)
FT                   /locus_tag="Y57G11C.701"
FT                   /standard_name="Y57G11C.701"
FT                   /product="Hypothetical RNA transcript Y57G11C.701"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(285097..285117)
FT                   /locus_tag="Y57G11C.702"
FT                   /standard_name="Y57G11C.702"
FT                   /product="Hypothetical RNA transcript Y57G11C.702"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199292..199312
FT                   /locus_tag="Y57G11C.703"
FT                   /standard_name="Y57G11C.703"
FT                   /product="Hypothetical RNA transcript Y57G11C.703"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(213148..213168)
FT                   /locus_tag="Y57G11C.704"
FT                   /standard_name="Y57G11C.704"
FT                   /product="Hypothetical RNA transcript Y57G11C.704"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           214657..214677
FT                   /locus_tag="Y57G11C.705"
FT                   /standard_name="Y57G11C.705"
FT                   /product="Hypothetical RNA transcript Y57G11C.705"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           115094..115114
FT                   /locus_tag="Y57G11C.706"
FT                   /standard_name="Y57G11C.706"
FT                   /product="Hypothetical RNA transcript Y57G11C.706"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50964..50984
FT                   /locus_tag="Y57G11C.707"
FT                   /standard_name="Y57G11C.707"
FT                   /product="Hypothetical RNA transcript Y57G11C.707"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(305931..305951)
FT                   /locus_tag="Y57G11C.708"
FT                   /standard_name="Y57G11C.708"
FT                   /product="Hypothetical RNA transcript Y57G11C.708"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119663..119683
FT                   /locus_tag="Y57G11C.709"
FT                   /standard_name="Y57G11C.709"
FT                   /product="Hypothetical RNA transcript Y57G11C.709"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(24689..24709)
FT                   /locus_tag="Y57G11C.710"
FT                   /standard_name="Y57G11C.710"
FT                   /product="Hypothetical RNA transcript Y57G11C.710"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243657..243677
FT                   /locus_tag="Y57G11C.711"
FT                   /standard_name="Y57G11C.711"
FT                   /product="Hypothetical RNA transcript Y57G11C.711"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(308450..308470)
FT                   /locus_tag="Y57G11C.712"
FT                   /standard_name="Y57G11C.712"
FT                   /product="Hypothetical RNA transcript Y57G11C.712"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264805..264825
FT                   /locus_tag="Y57G11C.713"
FT                   /standard_name="Y57G11C.713"
FT                   /product="Hypothetical RNA transcript Y57G11C.713"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           49499..49519
FT                   /locus_tag="Y57G11C.714"
FT                   /standard_name="Y57G11C.714"
FT                   /product="Hypothetical RNA transcript Y57G11C.714"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(88896..88916)
FT                   /locus_tag="Y57G11C.715"
FT                   /standard_name="Y57G11C.715"
FT                   /product="Hypothetical RNA transcript Y57G11C.715"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243580..243600
FT                   /locus_tag="Y57G11C.716"
FT                   /standard_name="Y57G11C.716"
FT                   /product="Hypothetical RNA transcript Y57G11C.716"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96378..96398
FT                   /locus_tag="Y57G11C.717"
FT                   /standard_name="Y57G11C.717"
FT                   /product="Hypothetical RNA transcript Y57G11C.717"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(242557..242577)
FT                   /locus_tag="Y57G11C.718"
FT                   /standard_name="Y57G11C.718"
FT                   /product="Hypothetical RNA transcript Y57G11C.718"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(285094..285114)
FT                   /locus_tag="Y57G11C.719"
FT                   /standard_name="Y57G11C.719"
FT                   /product="Hypothetical RNA transcript Y57G11C.719"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           304741..304761
FT                   /locus_tag="Y57G11C.720"
FT                   /standard_name="Y57G11C.720"
FT                   /product="Hypothetical RNA transcript Y57G11C.720"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           310130..310150
FT                   /locus_tag="Y57G11C.721"
FT                   /standard_name="Y57G11C.721"
FT                   /product="Hypothetical RNA transcript Y57G11C.721"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(304180..304200)
FT                   /locus_tag="Y57G11C.722"
FT                   /standard_name="Y57G11C.722"
FT                   /product="Hypothetical RNA transcript Y57G11C.722"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           289087..289107
FT                   /locus_tag="Y57G11C.723"
FT                   /standard_name="Y57G11C.723"
FT                   /product="Hypothetical RNA transcript Y57G11C.723"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           2303..2323
FT                   /locus_tag="Y57G11C.724"
FT                   /standard_name="Y57G11C.724"
FT                   /product="Hypothetical RNA transcript Y57G11C.724"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           257902..257922
FT                   /locus_tag="Y57G11C.725"
FT                   /standard_name="Y57G11C.725"
FT                   /product="Hypothetical RNA transcript Y57G11C.725"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           175910..175930
FT                   /locus_tag="Y57G11C.726"
FT                   /standard_name="Y57G11C.726"
FT                   /product="Hypothetical RNA transcript Y57G11C.726"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(192414..192434)
FT                   /locus_tag="Y57G11C.727"
FT                   /standard_name="Y57G11C.727"
FT                   /product="Hypothetical RNA transcript Y57G11C.727"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           88368..88388
FT                   /locus_tag="Y57G11C.728"
FT                   /standard_name="Y57G11C.728"
FT                   /product="Hypothetical RNA transcript Y57G11C.728"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(27284..27304)
FT                   /locus_tag="Y57G11C.729"
FT                   /standard_name="Y57G11C.729"
FT                   /product="Hypothetical RNA transcript Y57G11C.729"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(114304..114324)
FT                   /locus_tag="Y57G11C.730"
FT                   /standard_name="Y57G11C.730"
FT                   /product="Hypothetical RNA transcript Y57G11C.730"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           65615..65635
FT                   /locus_tag="Y57G11C.731"
FT                   /standard_name="Y57G11C.731"
FT                   /product="Hypothetical RNA transcript Y57G11C.731"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12176..12196
FT                   /locus_tag="Y57G11C.732"
FT                   /standard_name="Y57G11C.732"
FT                   /product="Hypothetical RNA transcript Y57G11C.732"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           78452..78472
FT                   /locus_tag="Y57G11C.733"
FT                   /standard_name="Y57G11C.733"
FT                   /product="Hypothetical RNA transcript Y57G11C.733"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           106328..106348
FT                   /locus_tag="Y57G11C.734"
FT                   /standard_name="Y57G11C.734"
FT                   /product="Hypothetical RNA transcript Y57G11C.734"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(240393..240413)
FT                   /locus_tag="Y57G11C.735"
FT                   /standard_name="Y57G11C.735"
FT                   /product="Hypothetical RNA transcript Y57G11C.735"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           3019..3039
FT                   /locus_tag="Y57G11C.736"
FT                   /standard_name="Y57G11C.736"
FT                   /product="Hypothetical RNA transcript Y57G11C.736"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50408..50428
FT                   /locus_tag="Y57G11C.737"
FT                   /standard_name="Y57G11C.737"
FT                   /product="Hypothetical RNA transcript Y57G11C.737"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242990..243010
FT                   /locus_tag="Y57G11C.738"
FT                   /standard_name="Y57G11C.738"
FT                   /product="Hypothetical RNA transcript Y57G11C.738"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242134..242154
FT                   /locus_tag="Y57G11C.739"
FT                   /standard_name="Y57G11C.739"
FT                   /product="Hypothetical RNA transcript Y57G11C.739"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           283763..283783
FT                   /locus_tag="Y57G11C.740"
FT                   /standard_name="Y57G11C.740"
FT                   /product="Hypothetical RNA transcript Y57G11C.740"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           200541..200561
FT                   /locus_tag="Y57G11C.741"
FT                   /standard_name="Y57G11C.741"
FT                   /product="Hypothetical RNA transcript Y57G11C.741"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264076..264096
FT                   /locus_tag="Y57G11C.742"
FT                   /standard_name="Y57G11C.742"
FT                   /product="Hypothetical RNA transcript Y57G11C.742"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           285880..285900
FT                   /locus_tag="Y57G11C.743"
FT                   /standard_name="Y57G11C.743"
FT                   /product="Hypothetical RNA transcript Y57G11C.743"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11777..11797
FT                   /locus_tag="Y57G11C.744"
FT                   /standard_name="Y57G11C.744"
FT                   /product="Hypothetical RNA transcript Y57G11C.744"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(215672..215692)
FT                   /locus_tag="Y57G11C.745"
FT                   /standard_name="Y57G11C.745"
FT                   /product="Hypothetical RNA transcript Y57G11C.745"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           220410..220430
FT                   /locus_tag="Y57G11C.746"
FT                   /standard_name="Y57G11C.746"
FT                   /product="Hypothetical RNA transcript Y57G11C.746"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(264312..264332)
FT                   /locus_tag="Y57G11C.747"
FT                   /standard_name="Y57G11C.747"
FT                   /product="Hypothetical RNA transcript Y57G11C.747"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(247792..247812)
FT                   /locus_tag="Y57G11C.748"
FT                   /standard_name="Y57G11C.748"
FT                   /product="Hypothetical RNA transcript Y57G11C.748"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           39007..39027
FT                   /locus_tag="Y57G11C.749"
FT                   /standard_name="Y57G11C.749"
FT                   /product="Hypothetical RNA transcript Y57G11C.749"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           44075..44095
FT                   /locus_tag="Y57G11C.750"
FT                   /standard_name="Y57G11C.750"
FT                   /product="Hypothetical RNA transcript Y57G11C.750"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           293762..293782
FT                   /locus_tag="Y57G11C.751"
FT                   /standard_name="Y57G11C.751"
FT                   /product="Hypothetical RNA transcript Y57G11C.751"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29715..29735)
FT                   /locus_tag="Y57G11C.752"
FT                   /standard_name="Y57G11C.752"
FT                   /product="Hypothetical RNA transcript Y57G11C.752"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199295..199315
FT                   /locus_tag="Y57G11C.753"
FT                   /standard_name="Y57G11C.753"
FT                   /product="Hypothetical RNA transcript Y57G11C.753"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(92539..92559)
FT                   /locus_tag="Y57G11C.754"
FT                   /standard_name="Y57G11C.754"
FT                   /product="Hypothetical RNA transcript Y57G11C.754"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           260843..260863
FT                   /locus_tag="Y57G11C.755"
FT                   /standard_name="Y57G11C.755"
FT                   /product="Hypothetical RNA transcript Y57G11C.755"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107917..107937
FT                   /locus_tag="Y57G11C.756"
FT                   /standard_name="Y57G11C.756"
FT                   /product="Hypothetical RNA transcript Y57G11C.756"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           37100..37120
FT                   /locus_tag="Y57G11C.757"
FT                   /standard_name="Y57G11C.757"
FT                   /product="Hypothetical RNA transcript Y57G11C.757"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           312808..312828
FT                   /locus_tag="Y57G11C.758"
FT                   /standard_name="Y57G11C.758"
FT                   /product="Hypothetical RNA transcript Y57G11C.758"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(267897..267917)
FT                   /locus_tag="Y57G11C.759"
FT                   /standard_name="Y57G11C.759"
FT                   /product="Hypothetical RNA transcript Y57G11C.759"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           260318..260338
FT                   /locus_tag="Y57G11C.760"
FT                   /standard_name="Y57G11C.760"
FT                   /product="Hypothetical RNA transcript Y57G11C.760"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           227359..227379
FT                   /locus_tag="Y57G11C.761"
FT                   /standard_name="Y57G11C.761"
FT                   /product="Hypothetical RNA transcript Y57G11C.761"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(106080..106100)
FT                   /locus_tag="Y57G11C.762"
FT                   /standard_name="Y57G11C.762"
FT                   /product="Hypothetical RNA transcript Y57G11C.762"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           15010..15030
FT                   /locus_tag="Y57G11C.763"
FT                   /standard_name="Y57G11C.763"
FT                   /product="Hypothetical RNA transcript Y57G11C.763"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           32259..32279
FT                   /locus_tag="Y57G11C.764"
FT                   /standard_name="Y57G11C.764"
FT                   /product="Hypothetical RNA transcript Y57G11C.764"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(166404..166424)
FT                   /locus_tag="Y57G11C.765"
FT                   /standard_name="Y57G11C.765"
FT                   /product="Hypothetical RNA transcript Y57G11C.765"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           29912..29932
FT                   /locus_tag="Y57G11C.766"
FT                   /standard_name="Y57G11C.766"
FT                   /product="Hypothetical RNA transcript Y57G11C.766"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           302830..302850
FT                   /locus_tag="Y57G11C.767"
FT                   /standard_name="Y57G11C.767"
FT                   /product="Hypothetical RNA transcript Y57G11C.767"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           259066..259086
FT                   /locus_tag="Y57G11C.768"
FT                   /standard_name="Y57G11C.768"
FT                   /product="Hypothetical RNA transcript Y57G11C.768"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(262258..262278)
FT                   /locus_tag="Y57G11C.769"
FT                   /standard_name="Y57G11C.769"
FT                   /product="Hypothetical RNA transcript Y57G11C.769"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           79839..79859
FT                   /locus_tag="Y57G11C.770"
FT                   /standard_name="Y57G11C.770"
FT                   /product="Hypothetical RNA transcript Y57G11C.770"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           177032..177052
FT                   /locus_tag="Y57G11C.771"
FT                   /standard_name="Y57G11C.771"
FT                   /product="Hypothetical RNA transcript Y57G11C.771"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           100964..100984
FT                   /locus_tag="Y57G11C.772"
FT                   /standard_name="Y57G11C.772"
FT                   /product="Hypothetical RNA transcript Y57G11C.772"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           49836..49856
FT                   /locus_tag="Y57G11C.773"
FT                   /standard_name="Y57G11C.773"
FT                   /product="Hypothetical RNA transcript Y57G11C.773"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           267996..268016
FT                   /locus_tag="Y57G11C.774"
FT                   /standard_name="Y57G11C.774"
FT                   /product="Hypothetical RNA transcript Y57G11C.774"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(164457..164477)
FT                   /locus_tag="Y57G11C.775"
FT                   /standard_name="Y57G11C.775"
FT                   /product="Hypothetical RNA transcript Y57G11C.775"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           181278..181298
FT                   /locus_tag="Y57G11C.776"
FT                   /standard_name="Y57G11C.776"
FT                   /product="Hypothetical RNA transcript Y57G11C.776"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107916..107936
FT                   /locus_tag="Y57G11C.777"
FT                   /standard_name="Y57G11C.777"
FT                   /product="Hypothetical RNA transcript Y57G11C.777"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           42968..42988
FT                   /locus_tag="Y57G11C.778"
FT                   /standard_name="Y57G11C.778"
FT                   /product="Hypothetical RNA transcript Y57G11C.778"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120689..120709
FT                   /locus_tag="Y57G11C.779"
FT                   /standard_name="Y57G11C.779"
FT                   /product="Hypothetical RNA transcript Y57G11C.779"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11694..11714
FT                   /locus_tag="Y57G11C.780"
FT                   /standard_name="Y57G11C.780"
FT                   /product="Hypothetical RNA transcript Y57G11C.780"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(16120..16140)
FT                   /locus_tag="Y57G11C.781"
FT                   /standard_name="Y57G11C.781"
FT                   /product="Hypothetical RNA transcript Y57G11C.781"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(244378..244398)
FT                   /locus_tag="Y57G11C.782"
FT                   /standard_name="Y57G11C.782"
FT                   /product="Hypothetical RNA transcript Y57G11C.782"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(288800..288820)
FT                   /locus_tag="Y57G11C.783"
FT                   /standard_name="Y57G11C.783"
FT                   /product="Hypothetical RNA transcript Y57G11C.783"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(176107..176127)
FT                   /locus_tag="Y57G11C.784"
FT                   /standard_name="Y57G11C.784"
FT                   /product="Hypothetical RNA transcript Y57G11C.784"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(12735..12755)
FT                   /locus_tag="Y57G11C.785"
FT                   /standard_name="Y57G11C.785"
FT                   /product="Hypothetical RNA transcript Y57G11C.785"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           9603..9623
FT                   /locus_tag="Y57G11C.786"
FT                   /standard_name="Y57G11C.786"
FT                   /product="Hypothetical RNA transcript Y57G11C.786"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(178515..178535)
FT                   /locus_tag="Y57G11C.787"
FT                   /standard_name="Y57G11C.787"
FT                   /product="Hypothetical RNA transcript Y57G11C.787"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           64349..64369
FT                   /locus_tag="Y57G11C.788"
FT                   /standard_name="Y57G11C.788"
FT                   /product="Hypothetical RNA transcript Y57G11C.788"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(301988..302008)
FT                   /locus_tag="Y57G11C.789"
FT                   /standard_name="Y57G11C.789"
FT                   /product="Hypothetical RNA transcript Y57G11C.789"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12178..12198
FT                   /locus_tag="Y57G11C.790"
FT                   /standard_name="Y57G11C.790"
FT                   /product="Hypothetical RNA transcript Y57G11C.790"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9742..9762)
FT                   /locus_tag="Y57G11C.791"
FT                   /standard_name="Y57G11C.791"
FT                   /product="Hypothetical RNA transcript Y57G11C.791"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(68099..68119)
FT                   /locus_tag="Y57G11C.792"
FT                   /standard_name="Y57G11C.792"
FT                   /product="Hypothetical RNA transcript Y57G11C.792"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           98869..98889
FT                   /locus_tag="Y57G11C.793"
FT                   /standard_name="Y57G11C.793"
FT                   /product="Hypothetical RNA transcript Y57G11C.793"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(69330..69350)
FT                   /locus_tag="Y57G11C.794"
FT                   /standard_name="Y57G11C.794"
FT                   /product="Hypothetical RNA transcript Y57G11C.794"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242038..242058
FT                   /locus_tag="Y57G11C.795"
FT                   /standard_name="Y57G11C.795"
FT                   /product="Hypothetical RNA transcript Y57G11C.795"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(255597..255617)
FT                   /locus_tag="Y57G11C.796"
FT                   /standard_name="Y57G11C.796"
FT                   /product="Hypothetical RNA transcript Y57G11C.796"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(60620..60640)
FT                   /locus_tag="Y57G11C.797"
FT                   /standard_name="Y57G11C.797"
FT                   /product="Hypothetical RNA transcript Y57G11C.797"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           237441..237461
FT                   /locus_tag="Y57G11C.798"
FT                   /standard_name="Y57G11C.798"
FT                   /product="Hypothetical RNA transcript Y57G11C.798"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           79744..79764
FT                   /locus_tag="Y57G11C.799"
FT                   /standard_name="Y57G11C.799"
FT                   /product="Hypothetical RNA transcript Y57G11C.799"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           282130..282150
FT                   /locus_tag="Y57G11C.800"
FT                   /standard_name="Y57G11C.800"
FT                   /product="Hypothetical RNA transcript Y57G11C.800"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(53311..53331)
FT                   /locus_tag="Y57G11C.801"
FT                   /standard_name="Y57G11C.801"
FT                   /product="Hypothetical RNA transcript Y57G11C.801"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(116142..116162)
FT                   /locus_tag="Y57G11C.802"
FT                   /standard_name="Y57G11C.802"
FT                   /product="Hypothetical RNA transcript Y57G11C.802"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(27550..27570)
FT                   /locus_tag="Y57G11C.803"
FT                   /standard_name="Y57G11C.803"
FT                   /product="Hypothetical RNA transcript Y57G11C.803"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9025..9045)
FT                   /locus_tag="Y57G11C.804"
FT                   /standard_name="Y57G11C.804"
FT                   /product="Hypothetical RNA transcript Y57G11C.804"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           246103..246123
FT                   /locus_tag="Y57G11C.805"
FT                   /standard_name="Y57G11C.805"
FT                   /product="Hypothetical RNA transcript Y57G11C.805"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           252582..252602
FT                   /locus_tag="Y57G11C.806"
FT                   /standard_name="Y57G11C.806"
FT                   /product="Hypothetical RNA transcript Y57G11C.806"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(238243..238263)
FT                   /locus_tag="Y57G11C.807"
FT                   /standard_name="Y57G11C.807"
FT                   /product="Hypothetical RNA transcript Y57G11C.807"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(237025..237045)
FT                   /locus_tag="Y57G11C.808"
FT                   /standard_name="Y57G11C.808"
FT                   /product="Hypothetical RNA transcript Y57G11C.808"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12402..12422
FT                   /locus_tag="Y57G11C.809"
FT                   /standard_name="Y57G11C.809"
FT                   /product="Hypothetical RNA transcript Y57G11C.809"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243485..243505
FT                   /locus_tag="Y57G11C.810"
FT                   /standard_name="Y57G11C.810"
FT                   /product="Hypothetical RNA transcript Y57G11C.810"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           17262..17282
FT                   /locus_tag="Y57G11C.811"
FT                   /standard_name="Y57G11C.811"
FT                   /product="Hypothetical RNA transcript Y57G11C.811"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247705..247725
FT                   /locus_tag="Y57G11C.812"
FT                   /standard_name="Y57G11C.812"
FT                   /product="Hypothetical RNA transcript Y57G11C.812"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           285662..285682
FT                   /locus_tag="Y57G11C.813"
FT                   /standard_name="Y57G11C.813"
FT                   /product="Hypothetical RNA transcript Y57G11C.813"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           7485..7505
FT                   /locus_tag="Y57G11C.814"
FT                   /standard_name="Y57G11C.814"
FT                   /product="Hypothetical RNA transcript Y57G11C.814"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           181017..181037
FT                   /locus_tag="Y57G11C.815"
FT                   /standard_name="Y57G11C.815"
FT                   /product="Hypothetical RNA transcript Y57G11C.815"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           99380..99400
FT                   /locus_tag="Y57G11C.816"
FT                   /standard_name="Y57G11C.816"
FT                   /product="Hypothetical RNA transcript Y57G11C.816"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(106914..106934)
FT                   /locus_tag="Y57G11C.817"
FT                   /standard_name="Y57G11C.817"
FT                   /product="Hypothetical RNA transcript Y57G11C.817"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47590..47610)
FT                   /locus_tag="Y57G11C.818"
FT                   /standard_name="Y57G11C.818"
FT                   /product="Hypothetical RNA transcript Y57G11C.818"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(59007..59027)
FT                   /locus_tag="Y57G11C.819"
FT                   /standard_name="Y57G11C.819"
FT                   /product="Hypothetical RNA transcript Y57G11C.819"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           64133..64153
FT                   /locus_tag="Y57G11C.820"
FT                   /standard_name="Y57G11C.820"
FT                   /product="Hypothetical RNA transcript Y57G11C.820"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(30283..30303)
FT                   /locus_tag="Y57G11C.821"
FT                   /standard_name="Y57G11C.821"
FT                   /product="Hypothetical RNA transcript Y57G11C.821"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232167..232187)
FT                   /locus_tag="Y57G11C.822"
FT                   /standard_name="Y57G11C.822"
FT                   /product="Hypothetical RNA transcript Y57G11C.822"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(59297..59317)
FT                   /locus_tag="Y57G11C.823"
FT                   /standard_name="Y57G11C.823"
FT                   /product="Hypothetical RNA transcript Y57G11C.823"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           211815..211835
FT                   /locus_tag="Y57G11C.824"
FT                   /standard_name="Y57G11C.824"
FT                   /product="Hypothetical RNA transcript Y57G11C.824"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           249313..249333
FT                   /locus_tag="Y57G11C.825"
FT                   /standard_name="Y57G11C.825"
FT                   /product="Hypothetical RNA transcript Y57G11C.825"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           103..123
FT                   /locus_tag="Y57G11C.826"
FT                   /standard_name="Y57G11C.826"
FT                   /product="Hypothetical RNA transcript Y57G11C.826"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           215063..215083
FT                   /locus_tag="Y57G11C.827"
FT                   /standard_name="Y57G11C.827"
FT                   /product="Hypothetical RNA transcript Y57G11C.827"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(227843..227863)
FT                   /locus_tag="Y57G11C.828"
FT                   /standard_name="Y57G11C.828"
FT                   /product="Hypothetical RNA transcript Y57G11C.828"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           104171..104191
FT                   /locus_tag="Y57G11C.829"
FT                   /standard_name="Y57G11C.829"
FT                   /product="Hypothetical RNA transcript Y57G11C.829"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242398..242418
FT                   /locus_tag="Y57G11C.830"
FT                   /standard_name="Y57G11C.830"
FT                   /product="Hypothetical RNA transcript Y57G11C.830"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           210876..210896
FT                   /locus_tag="Y57G11C.831"
FT                   /standard_name="Y57G11C.831"
FT                   /product="Hypothetical RNA transcript Y57G11C.831"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(64603..64623)
FT                   /locus_tag="Y57G11C.832"
FT                   /standard_name="Y57G11C.832"
FT                   /product="Hypothetical RNA transcript Y57G11C.832"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(28061..28081)
FT                   /locus_tag="Y57G11C.833"
FT                   /standard_name="Y57G11C.833"
FT                   /product="Hypothetical RNA transcript Y57G11C.833"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(75868..75888)
FT                   /locus_tag="Y57G11C.834"
FT                   /standard_name="Y57G11C.834"
FT                   /product="Hypothetical RNA transcript Y57G11C.834"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(197896..197916)
FT                   /locus_tag="Y57G11C.835"
FT                   /standard_name="Y57G11C.835"
FT                   /product="Hypothetical RNA transcript Y57G11C.835"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(127202..127222)
FT                   /locus_tag="Y57G11C.836"
FT                   /standard_name="Y57G11C.836"
FT                   /product="Hypothetical RNA transcript Y57G11C.836"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(262260..262280)
FT                   /locus_tag="Y57G11C.837"
FT                   /standard_name="Y57G11C.837"
FT                   /product="Hypothetical RNA transcript Y57G11C.837"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           116835..116855
FT                   /locus_tag="Y57G11C.838"
FT                   /standard_name="Y57G11C.838"
FT                   /product="Hypothetical RNA transcript Y57G11C.838"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(72932..72952)
FT                   /locus_tag="Y57G11C.839"
FT                   /standard_name="Y57G11C.839"
FT                   /product="Hypothetical RNA transcript Y57G11C.839"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(238588..238608)
FT                   /locus_tag="Y57G11C.840"
FT                   /standard_name="Y57G11C.840"
FT                   /product="Hypothetical RNA transcript Y57G11C.840"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           262085..262105
FT                   /locus_tag="Y57G11C.841"
FT                   /standard_name="Y57G11C.841"
FT                   /product="Hypothetical RNA transcript Y57G11C.841"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120271..120291
FT                   /locus_tag="Y57G11C.842"
FT                   /standard_name="Y57G11C.842"
FT                   /product="Hypothetical RNA transcript Y57G11C.842"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214733..214753)
FT                   /locus_tag="Y57G11C.843"
FT                   /standard_name="Y57G11C.843"
FT                   /product="Hypothetical RNA transcript Y57G11C.843"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(309384..309404)
FT                   /locus_tag="Y57G11C.844"
FT                   /standard_name="Y57G11C.844"
FT                   /product="Hypothetical RNA transcript Y57G11C.844"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(49010..49030)
FT                   /locus_tag="Y57G11C.845"
FT                   /standard_name="Y57G11C.845"
FT                   /product="Hypothetical RNA transcript Y57G11C.845"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77169..77189)
FT                   /locus_tag="Y57G11C.846"
FT                   /standard_name="Y57G11C.846"
FT                   /product="Hypothetical RNA transcript Y57G11C.846"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(33755..33775)
FT                   /locus_tag="Y57G11C.847"
FT                   /standard_name="Y57G11C.847"
FT                   /product="Hypothetical RNA transcript Y57G11C.847"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(276210..276230)
FT                   /locus_tag="Y57G11C.848"
FT                   /standard_name="Y57G11C.848"
FT                   /product="Hypothetical RNA transcript Y57G11C.848"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           253336..253356
FT                   /locus_tag="Y57G11C.849"
FT                   /standard_name="Y57G11C.849"
FT                   /product="Hypothetical RNA transcript Y57G11C.849"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195408..195428)
FT                   /locus_tag="Y57G11C.850"
FT                   /standard_name="Y57G11C.850"
FT                   /product="Hypothetical RNA transcript Y57G11C.850"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           116837..116857
FT                   /locus_tag="Y57G11C.851"
FT                   /standard_name="Y57G11C.851"
FT                   /product="Hypothetical RNA transcript Y57G11C.851"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           107413..107433
FT                   /locus_tag="Y57G11C.852"
FT                   /standard_name="Y57G11C.852"
FT                   /product="Hypothetical RNA transcript Y57G11C.852"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(304181..304201)
FT                   /locus_tag="Y57G11C.853"
FT                   /standard_name="Y57G11C.853"
FT                   /product="Hypothetical RNA transcript Y57G11C.853"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(213887..213907)
FT                   /locus_tag="Y57G11C.854"
FT                   /standard_name="Y57G11C.854"
FT                   /product="Hypothetical RNA transcript Y57G11C.854"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(279244..279264)
FT                   /locus_tag="Y57G11C.855"
FT                   /standard_name="Y57G11C.855"
FT                   /product="Hypothetical RNA transcript Y57G11C.855"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(77171..77191)
FT                   /locus_tag="Y57G11C.856"
FT                   /standard_name="Y57G11C.856"
FT                   /product="Hypothetical RNA transcript Y57G11C.856"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           175077..175097
FT                   /locus_tag="Y57G11C.857"
FT                   /standard_name="Y57G11C.857"
FT                   /product="Hypothetical RNA transcript Y57G11C.857"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(194749..194769)
FT                   /locus_tag="Y57G11C.858"
FT                   /standard_name="Y57G11C.858"
FT                   /product="Hypothetical RNA transcript Y57G11C.858"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(178389..178409)
FT                   /locus_tag="Y57G11C.859"
FT                   /standard_name="Y57G11C.859"
FT                   /product="Hypothetical RNA transcript Y57G11C.859"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           264074..264094
FT                   /locus_tag="Y57G11C.860"
FT                   /standard_name="Y57G11C.860"
FT                   /product="Hypothetical RNA transcript Y57G11C.860"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           172000..172020
FT                   /locus_tag="Y57G11C.861"
FT                   /standard_name="Y57G11C.861"
FT                   /product="Hypothetical RNA transcript Y57G11C.861"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           84439..84459
FT                   /locus_tag="Y57G11C.862"
FT                   /standard_name="Y57G11C.862"
FT                   /product="Hypothetical RNA transcript Y57G11C.862"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(53313..53333)
FT                   /locus_tag="Y57G11C.863"
FT                   /standard_name="Y57G11C.863"
FT                   /product="Hypothetical RNA transcript Y57G11C.863"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(70036..70056)
FT                   /locus_tag="Y57G11C.864"
FT                   /standard_name="Y57G11C.864"
FT                   /product="Hypothetical RNA transcript Y57G11C.864"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           39060..39080
FT                   /locus_tag="Y57G11C.865"
FT                   /standard_name="Y57G11C.865"
FT                   /product="Hypothetical RNA transcript Y57G11C.865"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243583..243603
FT                   /locus_tag="Y57G11C.866"
FT                   /standard_name="Y57G11C.866"
FT                   /product="Hypothetical RNA transcript Y57G11C.866"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195407..195427)
FT                   /locus_tag="Y57G11C.867"
FT                   /standard_name="Y57G11C.867"
FT                   /product="Hypothetical RNA transcript Y57G11C.867"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           235948..235968
FT                   /locus_tag="Y57G11C.868"
FT                   /standard_name="Y57G11C.868"
FT                   /product="Hypothetical RNA transcript Y57G11C.868"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(35911..35931)
FT                   /locus_tag="Y57G11C.869"
FT                   /standard_name="Y57G11C.869"
FT                   /product="Hypothetical RNA transcript Y57G11C.869"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232174..232194)
FT                   /locus_tag="Y57G11C.870"
FT                   /standard_name="Y57G11C.870"
FT                   /product="Hypothetical RNA transcript Y57G11C.870"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(234908..234928)
FT                   /locus_tag="Y57G11C.871"
FT                   /standard_name="Y57G11C.871"
FT                   /product="Hypothetical RNA transcript Y57G11C.871"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(294223..294243)
FT                   /locus_tag="Y57G11C.872"
FT                   /standard_name="Y57G11C.872"
FT                   /product="Hypothetical RNA transcript Y57G11C.872"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(94700..94720)
FT                   /locus_tag="Y57G11C.873"
FT                   /standard_name="Y57G11C.873"
FT                   /product="Hypothetical RNA transcript Y57G11C.873"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           216168..216188
FT                   /locus_tag="Y57G11C.874"
FT                   /standard_name="Y57G11C.874"
FT                   /product="Hypothetical RNA transcript Y57G11C.874"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195682..195702)
FT                   /locus_tag="Y57G11C.875"
FT                   /standard_name="Y57G11C.875"
FT                   /product="Hypothetical RNA transcript Y57G11C.875"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           10449..10469
FT                   /locus_tag="Y57G11C.876"
FT                   /standard_name="Y57G11C.876"
FT                   /product="Hypothetical RNA transcript Y57G11C.876"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281951..281971
FT                   /locus_tag="Y57G11C.877"
FT                   /standard_name="Y57G11C.877"
FT                   /product="Hypothetical RNA transcript Y57G11C.877"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(56731..56751)
FT                   /locus_tag="Y57G11C.878"
FT                   /standard_name="Y57G11C.878"
FT                   /product="Hypothetical RNA transcript Y57G11C.878"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           216437..216457
FT                   /locus_tag="Y57G11C.879"
FT                   /standard_name="Y57G11C.879"
FT                   /product="Hypothetical RNA transcript Y57G11C.879"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281941..281961
FT                   /locus_tag="Y57G11C.880"
FT                   /standard_name="Y57G11C.880"
FT                   /product="Hypothetical RNA transcript Y57G11C.880"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(111362..111382)
FT                   /locus_tag="Y57G11C.881"
FT                   /standard_name="Y57G11C.881"
FT                   /product="Hypothetical RNA transcript Y57G11C.881"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30523..30543
FT                   /locus_tag="Y57G11C.882"
FT                   /standard_name="Y57G11C.882"
FT                   /product="Hypothetical RNA transcript Y57G11C.882"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(56474..56494)
FT                   /locus_tag="Y57G11C.883"
FT                   /standard_name="Y57G11C.883"
FT                   /product="Hypothetical RNA transcript Y57G11C.883"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(30286..30306)
FT                   /locus_tag="Y57G11C.884"
FT                   /standard_name="Y57G11C.884"
FT                   /product="Hypothetical RNA transcript Y57G11C.884"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(96512..96532)
FT                   /locus_tag="Y57G11C.885"
FT                   /standard_name="Y57G11C.885"
FT                   /product="Hypothetical RNA transcript Y57G11C.885"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(241429..241449)
FT                   /locus_tag="Y57G11C.886"
FT                   /standard_name="Y57G11C.886"
FT                   /product="Hypothetical RNA transcript Y57G11C.886"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(17216..17236)
FT                   /locus_tag="Y57G11C.887"
FT                   /standard_name="Y57G11C.887"
FT                   /product="Hypothetical RNA transcript Y57G11C.887"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           84232..84252
FT                   /locus_tag="Y57G11C.888"
FT                   /standard_name="Y57G11C.888"
FT                   /product="Hypothetical RNA transcript Y57G11C.888"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(265260..265280)
FT                   /locus_tag="Y57G11C.889"
FT                   /standard_name="Y57G11C.889"
FT                   /product="Hypothetical RNA transcript Y57G11C.889"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           311805..311825
FT                   /locus_tag="Y57G11C.890"
FT                   /standard_name="Y57G11C.890"
FT                   /product="Hypothetical RNA transcript Y57G11C.890"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(35458..35478)
FT                   /locus_tag="Y57G11C.891"
FT                   /standard_name="Y57G11C.891"
FT                   /product="Hypothetical RNA transcript Y57G11C.891"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(225887..225907)
FT                   /locus_tag="Y57G11C.892"
FT                   /standard_name="Y57G11C.892"
FT                   /product="Hypothetical RNA transcript Y57G11C.892"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(26086..26106)
FT                   /locus_tag="Y57G11C.893"
FT                   /standard_name="Y57G11C.893"
FT                   /product="Hypothetical RNA transcript Y57G11C.893"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(113617..113637)
FT                   /locus_tag="Y57G11C.894"
FT                   /standard_name="Y57G11C.894"
FT                   /product="Hypothetical RNA transcript Y57G11C.894"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           64134..64154
FT                   /locus_tag="Y57G11C.895"
FT                   /standard_name="Y57G11C.895"
FT                   /product="Hypothetical RNA transcript Y57G11C.895"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250057..250077)
FT                   /locus_tag="Y57G11C.896"
FT                   /standard_name="Y57G11C.896"
FT                   /product="Hypothetical RNA transcript Y57G11C.896"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(111358..111378)
FT                   /locus_tag="Y57G11C.897"
FT                   /standard_name="Y57G11C.897"
FT                   /product="Hypothetical RNA transcript Y57G11C.897"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(269234..269254)
FT                   /locus_tag="Y57G11C.898"
FT                   /standard_name="Y57G11C.898"
FT                   /product="Hypothetical RNA transcript Y57G11C.898"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214129..214149)
FT                   /locus_tag="Y57G11C.899"
FT                   /standard_name="Y57G11C.899"
FT                   /product="Hypothetical RNA transcript Y57G11C.899"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(82867..82887)
FT                   /locus_tag="Y57G11C.900"
FT                   /standard_name="Y57G11C.900"
FT                   /product="Hypothetical RNA transcript Y57G11C.900"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(27553..27573)
FT                   /locus_tag="Y57G11C.901"
FT                   /standard_name="Y57G11C.901"
FT                   /product="Hypothetical RNA transcript Y57G11C.901"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           182761..182781
FT                   /locus_tag="Y57G11C.902"
FT                   /standard_name="Y57G11C.902"
FT                   /product="Hypothetical RNA transcript Y57G11C.902"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(259549..259569)
FT                   /locus_tag="Y57G11C.903"
FT                   /standard_name="Y57G11C.903"
FT                   /product="Hypothetical RNA transcript Y57G11C.903"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           90043..90063
FT                   /locus_tag="Y57G11C.904"
FT                   /standard_name="Y57G11C.904"
FT                   /product="Hypothetical RNA transcript Y57G11C.904"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195928..195948)
FT                   /locus_tag="Y57G11C.905"
FT                   /standard_name="Y57G11C.905"
FT                   /product="Hypothetical RNA transcript Y57G11C.905"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           252184..252204
FT                   /locus_tag="Y57G11C.906"
FT                   /standard_name="Y57G11C.906"
FT                   /product="Hypothetical RNA transcript Y57G11C.906"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           24409..24429
FT                   /locus_tag="Y57G11C.907"
FT                   /standard_name="Y57G11C.907"
FT                   /product="Hypothetical RNA transcript Y57G11C.907"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(293989..294009)
FT                   /locus_tag="Y57G11C.908"
FT                   /standard_name="Y57G11C.908"
FT                   /product="Hypothetical RNA transcript Y57G11C.908"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(41640..41660)
FT                   /locus_tag="Y57G11C.909"
FT                   /standard_name="Y57G11C.909"
FT                   /product="Hypothetical RNA transcript Y57G11C.909"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           173673..173693
FT                   /locus_tag="Y57G11C.910"
FT                   /standard_name="Y57G11C.910"
FT                   /product="Hypothetical RNA transcript Y57G11C.910"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           184004..184024
FT                   /locus_tag="Y57G11C.911"
FT                   /standard_name="Y57G11C.911"
FT                   /product="Hypothetical RNA transcript Y57G11C.911"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           109564..109584
FT                   /locus_tag="Y57G11C.912"
FT                   /standard_name="Y57G11C.912"
FT                   /product="Hypothetical RNA transcript Y57G11C.912"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           15298..15318
FT                   /locus_tag="Y57G11C.913"
FT                   /standard_name="Y57G11C.913"
FT                   /product="Hypothetical RNA transcript Y57G11C.913"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           7920..7940
FT                   /locus_tag="Y57G11C.914"
FT                   /standard_name="Y57G11C.914"
FT                   /product="Hypothetical RNA transcript Y57G11C.914"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(82870..82890)
FT                   /locus_tag="Y57G11C.915"
FT                   /standard_name="Y57G11C.915"
FT                   /product="Hypothetical RNA transcript Y57G11C.915"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           78596..78616
FT                   /locus_tag="Y57G11C.916"
FT                   /standard_name="Y57G11C.916"
FT                   /product="Hypothetical RNA transcript Y57G11C.916"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(40299..40319)
FT                   /locus_tag="Y57G11C.917"
FT                   /standard_name="Y57G11C.917"
FT                   /product="Hypothetical RNA transcript Y57G11C.917"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(99093..99113)
FT                   /locus_tag="Y57G11C.918"
FT                   /standard_name="Y57G11C.918"
FT                   /product="Hypothetical RNA transcript Y57G11C.918"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           30730..30750
FT                   /locus_tag="Y57G11C.919"
FT                   /standard_name="Y57G11C.919"
FT                   /product="Hypothetical RNA transcript Y57G11C.919"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(81947..81967)
FT                   /locus_tag="Y57G11C.920"
FT                   /standard_name="Y57G11C.920"
FT                   /product="Hypothetical RNA transcript Y57G11C.920"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233165..233185
FT                   /locus_tag="Y57G11C.921"
FT                   /standard_name="Y57G11C.921"
FT                   /product="Hypothetical RNA transcript Y57G11C.921"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281940..281960
FT                   /locus_tag="Y57G11C.922"
FT                   /standard_name="Y57G11C.922"
FT                   /product="Hypothetical RNA transcript Y57G11C.922"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           168207..168227
FT                   /locus_tag="Y57G11C.923"
FT                   /standard_name="Y57G11C.923"
FT                   /product="Hypothetical RNA transcript Y57G11C.923"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(109234..109254)
FT                   /locus_tag="Y57G11C.924"
FT                   /standard_name="Y57G11C.924"
FT                   /product="Hypothetical RNA transcript Y57G11C.924"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           285952..285972
FT                   /locus_tag="Y57G11C.925"
FT                   /standard_name="Y57G11C.925"
FT                   /product="Hypothetical RNA transcript Y57G11C.925"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           220576..220596
FT                   /locus_tag="Y57G11C.926"
FT                   /standard_name="Y57G11C.926"
FT                   /product="Hypothetical RNA transcript Y57G11C.926"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           236528..236548
FT                   /locus_tag="Y57G11C.927"
FT                   /standard_name="Y57G11C.927"
FT                   /product="Hypothetical RNA transcript Y57G11C.927"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(166403..166423)
FT                   /locus_tag="Y57G11C.928"
FT                   /standard_name="Y57G11C.928"
FT                   /product="Hypothetical RNA transcript Y57G11C.928"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           281722..281742
FT                   /locus_tag="Y57G11C.929"
FT                   /standard_name="Y57G11C.929"
FT                   /product="Hypothetical RNA transcript Y57G11C.929"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           230537..230557
FT                   /locus_tag="Y57G11C.930"
FT                   /standard_name="Y57G11C.930"
FT                   /product="Hypothetical RNA transcript Y57G11C.930"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           270010..270030
FT                   /locus_tag="Y57G11C.931"
FT                   /standard_name="Y57G11C.931"
FT                   /product="Hypothetical RNA transcript Y57G11C.931"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(9022..9042)
FT                   /locus_tag="Y57G11C.932"
FT                   /standard_name="Y57G11C.932"
FT                   /product="Hypothetical RNA transcript Y57G11C.932"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(34853..34873)
FT                   /locus_tag="Y57G11C.933"
FT                   /standard_name="Y57G11C.933"
FT                   /product="Hypothetical RNA transcript Y57G11C.933"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195929..195949)
FT                   /locus_tag="Y57G11C.934"
FT                   /standard_name="Y57G11C.934"
FT                   /product="Hypothetical RNA transcript Y57G11C.934"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           254156..254176
FT                   /locus_tag="Y57G11C.935"
FT                   /standard_name="Y57G11C.935"
FT                   /product="Hypothetical RNA transcript Y57G11C.935"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           116089..116109
FT                   /locus_tag="Y57G11C.936"
FT                   /standard_name="Y57G11C.936"
FT                   /product="Hypothetical RNA transcript Y57G11C.936"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           182867..182887
FT                   /locus_tag="Y57G11C.937"
FT                   /standard_name="Y57G11C.937"
FT                   /product="Hypothetical RNA transcript Y57G11C.937"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           9770..9790
FT                   /locus_tag="Y57G11C.938"
FT                   /standard_name="Y57G11C.938"
FT                   /product="Hypothetical RNA transcript Y57G11C.938"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(218448..218468)
FT                   /locus_tag="Y57G11C.939"
FT                   /standard_name="Y57G11C.939"
FT                   /product="Hypothetical RNA transcript Y57G11C.939"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(221902..221922)
FT                   /locus_tag="Y57G11C.940"
FT                   /standard_name="Y57G11C.940"
FT                   /product="Hypothetical RNA transcript Y57G11C.940"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306279..306299)
FT                   /locus_tag="Y57G11C.941"
FT                   /standard_name="Y57G11C.941"
FT                   /product="Hypothetical RNA transcript Y57G11C.941"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(55130..55150)
FT                   /locus_tag="Y57G11C.942"
FT                   /standard_name="Y57G11C.942"
FT                   /product="Hypothetical RNA transcript Y57G11C.942"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(238660..238680)
FT                   /locus_tag="Y57G11C.943"
FT                   /standard_name="Y57G11C.943"
FT                   /product="Hypothetical RNA transcript Y57G11C.943"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           215059..215079
FT                   /locus_tag="Y57G11C.944"
FT                   /standard_name="Y57G11C.944"
FT                   /product="Hypothetical RNA transcript Y57G11C.944"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(240207..240227)
FT                   /locus_tag="Y57G11C.945"
FT                   /standard_name="Y57G11C.945"
FT                   /product="Hypothetical RNA transcript Y57G11C.945"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           92706..92726
FT                   /locus_tag="Y57G11C.946"
FT                   /standard_name="Y57G11C.946"
FT                   /product="Hypothetical RNA transcript Y57G11C.946"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           196147..196167
FT                   /locus_tag="Y57G11C.947"
FT                   /standard_name="Y57G11C.947"
FT                   /product="Hypothetical RNA transcript Y57G11C.947"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58991..59011
FT                   /locus_tag="Y57G11C.948"
FT                   /standard_name="Y57G11C.948"
FT                   /product="Hypothetical RNA transcript Y57G11C.948"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(177831..177851)
FT                   /locus_tag="Y57G11C.949"
FT                   /standard_name="Y57G11C.949"
FT                   /product="Hypothetical RNA transcript Y57G11C.949"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           198035..198055
FT                   /locus_tag="Y57G11C.950"
FT                   /standard_name="Y57G11C.950"
FT                   /product="Hypothetical RNA transcript Y57G11C.950"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           230992..231012
FT                   /locus_tag="Y57G11C.951"
FT                   /standard_name="Y57G11C.951"
FT                   /product="Hypothetical RNA transcript Y57G11C.951"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           248872..248892
FT                   /locus_tag="Y57G11C.952"
FT                   /standard_name="Y57G11C.952"
FT                   /product="Hypothetical RNA transcript Y57G11C.952"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(120103..120123)
FT                   /locus_tag="Y57G11C.953"
FT                   /standard_name="Y57G11C.953"
FT                   /product="Hypothetical RNA transcript Y57G11C.953"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(86226..86246)
FT                   /locus_tag="Y57G11C.954"
FT                   /standard_name="Y57G11C.954"
FT                   /product="Hypothetical RNA transcript Y57G11C.954"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(12971..12991)
FT                   /locus_tag="Y57G11C.955"
FT                   /standard_name="Y57G11C.955"
FT                   /product="Hypothetical RNA transcript Y57G11C.955"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           268523..268543
FT                   /locus_tag="Y57G11C.956"
FT                   /standard_name="Y57G11C.956"
FT                   /product="Hypothetical RNA transcript Y57G11C.956"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243810..243830
FT                   /locus_tag="Y57G11C.957"
FT                   /standard_name="Y57G11C.957"
FT                   /product="Hypothetical RNA transcript Y57G11C.957"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           57916..57936
FT                   /locus_tag="Y57G11C.958"
FT                   /standard_name="Y57G11C.958"
FT                   /product="Hypothetical RNA transcript Y57G11C.958"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(113989..114009)
FT                   /locus_tag="Y57G11C.959"
FT                   /standard_name="Y57G11C.959"
FT                   /product="Hypothetical RNA transcript Y57G11C.959"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12401..12421
FT                   /locus_tag="Y57G11C.960"
FT                   /standard_name="Y57G11C.960"
FT                   /product="Hypothetical RNA transcript Y57G11C.960"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(81000..81020)
FT                   /locus_tag="Y57G11C.961"
FT                   /standard_name="Y57G11C.961"
FT                   /product="Hypothetical RNA transcript Y57G11C.961"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(75307..75327)
FT                   /locus_tag="Y57G11C.962"
FT                   /standard_name="Y57G11C.962"
FT                   /product="Hypothetical RNA transcript Y57G11C.962"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           96379..96399
FT                   /locus_tag="Y57G11C.963"
FT                   /standard_name="Y57G11C.963"
FT                   /product="Hypothetical RNA transcript Y57G11C.963"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           17266..17286
FT                   /locus_tag="Y57G11C.964"
FT                   /standard_name="Y57G11C.964"
FT                   /product="Hypothetical RNA transcript Y57G11C.964"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           11774..11794
FT                   /locus_tag="Y57G11C.965"
FT                   /standard_name="Y57G11C.965"
FT                   /product="Hypothetical RNA transcript Y57G11C.965"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           285658..285678
FT                   /locus_tag="Y57G11C.966"
FT                   /standard_name="Y57G11C.966"
FT                   /product="Hypothetical RNA transcript Y57G11C.966"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(96864..96884)
FT                   /locus_tag="Y57G11C.967"
FT                   /standard_name="Y57G11C.967"
FT                   /product="Hypothetical RNA transcript Y57G11C.967"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           50963..50983
FT                   /locus_tag="Y57G11C.968"
FT                   /standard_name="Y57G11C.968"
FT                   /product="Hypothetical RNA transcript Y57G11C.968"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(170618..170638)
FT                   /locus_tag="Y57G11C.969"
FT                   /standard_name="Y57G11C.969"
FT                   /product="Hypothetical RNA transcript Y57G11C.969"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(216991..217011)
FT                   /locus_tag="Y57G11C.970"
FT                   /standard_name="Y57G11C.970"
FT                   /product="Hypothetical RNA transcript Y57G11C.970"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           283388..283408
FT                   /locus_tag="Y57G11C.971"
FT                   /standard_name="Y57G11C.971"
FT                   /product="Hypothetical RNA transcript Y57G11C.971"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           81609..81629
FT                   /locus_tag="Y57G11C.972"
FT                   /standard_name="Y57G11C.972"
FT                   /product="Hypothetical RNA transcript Y57G11C.972"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(232171..232191)
FT                   /locus_tag="Y57G11C.973"
FT                   /standard_name="Y57G11C.973"
FT                   /product="Hypothetical RNA transcript Y57G11C.973"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           192620..192640
FT                   /locus_tag="Y57G11C.974"
FT                   /standard_name="Y57G11C.974"
FT                   /product="Hypothetical RNA transcript Y57G11C.974"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           115771..115791
FT                   /locus_tag="Y57G11C.975"
FT                   /standard_name="Y57G11C.975"
FT                   /product="Hypothetical RNA transcript Y57G11C.975"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           109565..109585
FT                   /locus_tag="Y57G11C.976"
FT                   /standard_name="Y57G11C.976"
FT                   /product="Hypothetical RNA transcript Y57G11C.976"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           16770..16790
FT                   /locus_tag="Y57G11C.977"
FT                   /standard_name="Y57G11C.977"
FT                   /product="Hypothetical RNA transcript Y57G11C.977"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           5544..5564
FT                   /locus_tag="Y57G11C.978"
FT                   /standard_name="Y57G11C.978"
FT                   /product="Hypothetical RNA transcript Y57G11C.978"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           236851..236871
FT                   /locus_tag="Y57G11C.979"
FT                   /standard_name="Y57G11C.979"
FT                   /product="Hypothetical RNA transcript Y57G11C.979"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           4619..4639
FT                   /locus_tag="Y57G11C.980"
FT                   /standard_name="Y57G11C.980"
FT                   /product="Hypothetical RNA transcript Y57G11C.980"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(67111..67131)
FT                   /locus_tag="Y57G11C.981"
FT                   /standard_name="Y57G11C.981"
FT                   /product="Hypothetical RNA transcript Y57G11C.981"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(87341..87361)
FT                   /locus_tag="Y57G11C.982"
FT                   /standard_name="Y57G11C.982"
FT                   /product="Hypothetical RNA transcript Y57G11C.982"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(277114..277134)
FT                   /locus_tag="Y57G11C.983"
FT                   /standard_name="Y57G11C.983"
FT                   /product="Hypothetical RNA transcript Y57G11C.983"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           228404..228424
FT                   /locus_tag="Y57G11C.984"
FT                   /standard_name="Y57G11C.984"
FT                   /product="Hypothetical RNA transcript Y57G11C.984"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(56169..56189)
FT                   /locus_tag="Y57G11C.985"
FT                   /standard_name="Y57G11C.985"
FT                   /product="Hypothetical RNA transcript Y57G11C.985"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(235522..235542)
FT                   /locus_tag="Y57G11C.986"
FT                   /standard_name="Y57G11C.986"
FT                   /product="Hypothetical RNA transcript Y57G11C.986"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250476..250496)
FT                   /locus_tag="Y57G11C.987"
FT                   /standard_name="Y57G11C.987"
FT                   /product="Hypothetical RNA transcript Y57G11C.987"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           295248..295268
FT                   /locus_tag="Y57G11C.988"
FT                   /standard_name="Y57G11C.988"
FT                   /product="Hypothetical RNA transcript Y57G11C.988"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247238..247258
FT                   /locus_tag="Y57G11C.989"
FT                   /standard_name="Y57G11C.989"
FT                   /product="Hypothetical RNA transcript Y57G11C.989"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(284883..284903)
FT                   /locus_tag="Y57G11C.990"
FT                   /standard_name="Y57G11C.990"
FT                   /product="Hypothetical RNA transcript Y57G11C.990"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           180860..180880
FT                   /locus_tag="Y57G11C.991"
FT                   /standard_name="Y57G11C.991"
FT                   /product="Hypothetical RNA transcript Y57G11C.991"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           75811..75831
FT                   /locus_tag="Y57G11C.992"
FT                   /standard_name="Y57G11C.992"
FT                   /product="Hypothetical RNA transcript Y57G11C.992"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(37284..37304)
FT                   /locus_tag="Y57G11C.993"
FT                   /standard_name="Y57G11C.993"
FT                   /product="Hypothetical RNA transcript Y57G11C.993"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           89541..89561
FT                   /locus_tag="Y57G11C.994"
FT                   /standard_name="Y57G11C.994"
FT                   /product="Hypothetical RNA transcript Y57G11C.994"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(279782..279802)
FT                   /locus_tag="Y57G11C.995"
FT                   /standard_name="Y57G11C.995"
FT                   /product="Hypothetical RNA transcript Y57G11C.995"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           13585..13605
FT                   /locus_tag="Y57G11C.996"
FT                   /standard_name="Y57G11C.996"
FT                   /product="Hypothetical RNA transcript Y57G11C.996"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(106469..106489)
FT                   /locus_tag="Y57G11C.997"
FT                   /standard_name="Y57G11C.997"
FT                   /product="Hypothetical RNA transcript Y57G11C.997"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           93784..93804
FT                   /locus_tag="Y57G11C.998"
FT                   /standard_name="Y57G11C.998"
FT                   /product="Hypothetical RNA transcript Y57G11C.998"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           243335..243355
FT                   /locus_tag="Y57G11C.999"
FT                   /standard_name="Y57G11C.999"
FT                   /product="Hypothetical RNA transcript Y57G11C.999"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           288853..288873
FT                   /locus_tag="Y57G11C.1000"
FT                   /standard_name="Y57G11C.1000"
FT                   /product="Hypothetical RNA transcript Y57G11C.1000"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           28325..28345
FT                   /locus_tag="Y57G11C.1001"
FT                   /standard_name="Y57G11C.1001"
FT                   /product="Hypothetical RNA transcript Y57G11C.1001"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           4402..4422
FT                   /locus_tag="Y57G11C.1002"
FT                   /standard_name="Y57G11C.1002"
FT                   /product="Hypothetical RNA transcript Y57G11C.1002"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           278070..278090
FT                   /locus_tag="Y57G11C.1003"
FT                   /standard_name="Y57G11C.1003"
FT                   /product="Hypothetical RNA transcript Y57G11C.1003"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(227096..227116)
FT                   /locus_tag="Y57G11C.1004"
FT                   /standard_name="Y57G11C.1004"
FT                   /product="Hypothetical RNA transcript Y57G11C.1004"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           58294..58314
FT                   /locus_tag="Y57G11C.1005"
FT                   /standard_name="Y57G11C.1005"
FT                   /product="Hypothetical RNA transcript Y57G11C.1005"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           99080..99100
FT                   /locus_tag="Y57G11C.1006"
FT                   /standard_name="Y57G11C.1006"
FT                   /product="Hypothetical RNA transcript Y57G11C.1006"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(37926..37946)
FT                   /locus_tag="Y57G11C.1007"
FT                   /standard_name="Y57G11C.1007"
FT                   /product="Hypothetical RNA transcript Y57G11C.1007"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(45389..45409)
FT                   /locus_tag="Y57G11C.1008"
FT                   /standard_name="Y57G11C.1008"
FT                   /product="Hypothetical RNA transcript Y57G11C.1008"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(278317..278337)
FT                   /locus_tag="Y57G11C.1009"
FT                   /standard_name="Y57G11C.1009"
FT                   /product="Hypothetical RNA transcript Y57G11C.1009"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(279780..279800)
FT                   /locus_tag="Y57G11C.1010"
FT                   /standard_name="Y57G11C.1010"
FT                   /product="Hypothetical RNA transcript Y57G11C.1010"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           277956..277976
FT                   /locus_tag="Y57G11C.1011"
FT                   /standard_name="Y57G11C.1011"
FT                   /product="Hypothetical RNA transcript Y57G11C.1011"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           163457..163477
FT                   /locus_tag="Y57G11C.1012"
FT                   /standard_name="Y57G11C.1012"
FT                   /product="Hypothetical RNA transcript Y57G11C.1012"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           166827..166847
FT                   /locus_tag="Y57G11C.1013"
FT                   /standard_name="Y57G11C.1013"
FT                   /product="Hypothetical RNA transcript Y57G11C.1013"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           233309..233329
FT                   /locus_tag="Y57G11C.1014"
FT                   /standard_name="Y57G11C.1014"
FT                   /product="Hypothetical RNA transcript Y57G11C.1014"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           192473..192493
FT                   /locus_tag="Y57G11C.1015"
FT                   /standard_name="Y57G11C.1015"
FT                   /product="Hypothetical RNA transcript Y57G11C.1015"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(35910..35930)
FT                   /locus_tag="Y57G11C.1016"
FT                   /standard_name="Y57G11C.1016"
FT                   /product="Hypothetical RNA transcript Y57G11C.1016"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           48916..48936
FT                   /locus_tag="Y57G11C.1017"
FT                   /standard_name="Y57G11C.1017"
FT                   /product="Hypothetical RNA transcript Y57G11C.1017"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(227916..227936)
FT                   /locus_tag="Y57G11C.1018"
FT                   /standard_name="Y57G11C.1018"
FT                   /product="Hypothetical RNA transcript Y57G11C.1018"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(70035..70055)
FT                   /locus_tag="Y57G11C.1019"
FT                   /standard_name="Y57G11C.1019"
FT                   /product="Hypothetical RNA transcript Y57G11C.1019"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           244288..244308
FT                   /locus_tag="Y57G11C.1020"
FT                   /standard_name="Y57G11C.1020"
FT                   /product="Hypothetical RNA transcript Y57G11C.1020"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(286437..286457)
FT                   /locus_tag="Y57G11C.1021"
FT                   /standard_name="Y57G11C.1021"
FT                   /product="Hypothetical RNA transcript Y57G11C.1021"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           179284..179304
FT                   /locus_tag="Y57G11C.1022"
FT                   /standard_name="Y57G11C.1022"
FT                   /product="Hypothetical RNA transcript Y57G11C.1022"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(306278..306298)
FT                   /locus_tag="Y57G11C.1023"
FT                   /standard_name="Y57G11C.1023"
FT                   /product="Hypothetical RNA transcript Y57G11C.1023"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           183071..183091
FT                   /locus_tag="Y57G11C.1024"
FT                   /standard_name="Y57G11C.1024"
FT                   /product="Hypothetical RNA transcript Y57G11C.1024"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(47586..47606)
FT                   /locus_tag="Y57G11C.1025"
FT                   /standard_name="Y57G11C.1025"
FT                   /product="Hypothetical RNA transcript Y57G11C.1025"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(74114..74134)
FT                   /locus_tag="Y57G11C.1026"
FT                   /standard_name="Y57G11C.1026"
FT                   /product="Hypothetical RNA transcript Y57G11C.1026"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(27348..27368)
FT                   /locus_tag="Y57G11C.1027"
FT                   /standard_name="Y57G11C.1027"
FT                   /product="Hypothetical RNA transcript Y57G11C.1027"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           59486..59506
FT                   /locus_tag="Y57G11C.1028"
FT                   /standard_name="Y57G11C.1028"
FT                   /product="Hypothetical RNA transcript Y57G11C.1028"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(227098..227118)
FT                   /locus_tag="Y57G11C.1029"
FT                   /standard_name="Y57G11C.1029"
FT                   /product="Hypothetical RNA transcript Y57G11C.1029"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           35020..35040
FT                   /locus_tag="Y57G11C.1030"
FT                   /standard_name="Y57G11C.1030"
FT                   /product="Hypothetical RNA transcript Y57G11C.1030"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           179775..179795
FT                   /locus_tag="Y57G11C.1031"
FT                   /standard_name="Y57G11C.1031"
FT                   /product="Hypothetical RNA transcript Y57G11C.1031"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199565..199585
FT                   /locus_tag="Y57G11C.1032"
FT                   /standard_name="Y57G11C.1032"
FT                   /product="Hypothetical RNA transcript Y57G11C.1032"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120692..120712
FT                   /locus_tag="Y57G11C.1033"
FT                   /standard_name="Y57G11C.1033"
FT                   /product="Hypothetical RNA transcript Y57G11C.1033"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           199023..199043
FT                   /locus_tag="Y57G11C.1034"
FT                   /standard_name="Y57G11C.1034"
FT                   /product="Hypothetical RNA transcript Y57G11C.1034"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           4620..4640
FT                   /locus_tag="Y57G11C.1035"
FT                   /standard_name="Y57G11C.1035"
FT                   /product="Hypothetical RNA transcript Y57G11C.1035"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(116603..116623)
FT                   /locus_tag="Y57G11C.1036"
FT                   /standard_name="Y57G11C.1036"
FT                   /product="Hypothetical RNA transcript Y57G11C.1036"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           125958..125978
FT                   /locus_tag="Y57G11C.1037"
FT                   /standard_name="Y57G11C.1037"
FT                   /product="Hypothetical RNA transcript Y57G11C.1037"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           54860..54880
FT                   /locus_tag="Y57G11C.1038"
FT                   /standard_name="Y57G11C.1038"
FT                   /product="Hypothetical RNA transcript Y57G11C.1038"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(116139..116159)
FT                   /locus_tag="Y57G11C.1039"
FT                   /standard_name="Y57G11C.1039"
FT                   /product="Hypothetical RNA transcript Y57G11C.1039"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(25954..25974)
FT                   /locus_tag="Y57G11C.1040"
FT                   /standard_name="Y57G11C.1040"
FT                   /product="Hypothetical RNA transcript Y57G11C.1040"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(240103..240123)
FT                   /locus_tag="Y57G11C.1041"
FT                   /standard_name="Y57G11C.1041"
FT                   /product="Hypothetical RNA transcript Y57G11C.1041"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(234730..234750)
FT                   /locus_tag="Y57G11C.1042"
FT                   /standard_name="Y57G11C.1042"
FT                   /product="Hypothetical RNA transcript Y57G11C.1042"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           177036..177056
FT                   /locus_tag="Y57G11C.1043"
FT                   /standard_name="Y57G11C.1043"
FT                   /product="Hypothetical RNA transcript Y57G11C.1043"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(196912..196932)
FT                   /locus_tag="Y57G11C.1044"
FT                   /standard_name="Y57G11C.1044"
FT                   /product="Hypothetical RNA transcript Y57G11C.1044"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           309707..309727
FT                   /locus_tag="Y57G11C.1045"
FT                   /standard_name="Y57G11C.1045"
FT                   /product="Hypothetical RNA transcript Y57G11C.1045"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           183338..183358
FT                   /locus_tag="Y57G11C.1046"
FT                   /standard_name="Y57G11C.1046"
FT                   /product="Hypothetical RNA transcript Y57G11C.1046"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(221300..221320)
FT                   /locus_tag="Y57G11C.1047"
FT                   /standard_name="Y57G11C.1047"
FT                   /product="Hypothetical RNA transcript Y57G11C.1047"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           288850..288870
FT                   /locus_tag="Y57G11C.1048"
FT                   /standard_name="Y57G11C.1048"
FT                   /product="Hypothetical RNA transcript Y57G11C.1048"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247062..247082
FT                   /locus_tag="Y57G11C.1049"
FT                   /standard_name="Y57G11C.1049"
FT                   /product="Hypothetical RNA transcript Y57G11C.1049"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(38347..38367)
FT                   /locus_tag="Y57G11C.1050"
FT                   /standard_name="Y57G11C.1050"
FT                   /product="Hypothetical RNA transcript Y57G11C.1050"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(16417..16437)
FT                   /locus_tag="Y57G11C.1051"
FT                   /standard_name="Y57G11C.1051"
FT                   /product="Hypothetical RNA transcript Y57G11C.1051"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(116380..116400)
FT                   /locus_tag="Y57G11C.1052"
FT                   /standard_name="Y57G11C.1052"
FT                   /product="Hypothetical RNA transcript Y57G11C.1052"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(171256..171276)
FT                   /locus_tag="Y57G11C.1053"
FT                   /standard_name="Y57G11C.1053"
FT                   /product="Hypothetical RNA transcript Y57G11C.1053"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(234782..234802)
FT                   /locus_tag="Y57G11C.1054"
FT                   /standard_name="Y57G11C.1054"
FT                   /product="Hypothetical RNA transcript Y57G11C.1054"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           230311..230331
FT                   /locus_tag="Y57G11C.1055"
FT                   /standard_name="Y57G11C.1055"
FT                   /product="Hypothetical RNA transcript Y57G11C.1055"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           212874..212894
FT                   /locus_tag="Y57G11C.1056"
FT                   /standard_name="Y57G11C.1056"
FT                   /product="Hypothetical RNA transcript Y57G11C.1056"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(23836..23856)
FT                   /locus_tag="Y57G11C.1057"
FT                   /standard_name="Y57G11C.1057"
FT                   /product="Hypothetical RNA transcript Y57G11C.1057"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           247140..247160
FT                   /locus_tag="Y57G11C.1058"
FT                   /standard_name="Y57G11C.1058"
FT                   /product="Hypothetical RNA transcript Y57G11C.1058"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           223941..223961
FT                   /locus_tag="Y57G11C.1059"
FT                   /standard_name="Y57G11C.1059"
FT                   /product="Hypothetical RNA transcript Y57G11C.1059"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           198036..198056
FT                   /locus_tag="Y57G11C.1060"
FT                   /standard_name="Y57G11C.1060"
FT                   /product="Hypothetical RNA transcript Y57G11C.1060"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(308454..308474)
FT                   /locus_tag="Y57G11C.1061"
FT                   /standard_name="Y57G11C.1061"
FT                   /product="Hypothetical RNA transcript Y57G11C.1061"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(43118..43138)
FT                   /locus_tag="Y57G11C.1062"
FT                   /standard_name="Y57G11C.1062"
FT                   /product="Hypothetical RNA transcript Y57G11C.1062"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           89065..89085
FT                   /locus_tag="Y57G11C.1063"
FT                   /standard_name="Y57G11C.1063"
FT                   /product="Hypothetical RNA transcript Y57G11C.1063"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(285096..285116)
FT                   /locus_tag="Y57G11C.1064"
FT                   /standard_name="Y57G11C.1064"
FT                   /product="Hypothetical RNA transcript Y57G11C.1064"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(273087..273107)
FT                   /locus_tag="Y57G11C.1065"
FT                   /standard_name="Y57G11C.1065"
FT                   /product="Hypothetical RNA transcript Y57G11C.1065"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(253621..253641)
FT                   /locus_tag="Y57G11C.1066"
FT                   /standard_name="Y57G11C.1066"
FT                   /product="Hypothetical RNA transcript Y57G11C.1066"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(221035..221055)
FT                   /locus_tag="Y57G11C.1067"
FT                   /standard_name="Y57G11C.1067"
FT                   /product="Hypothetical RNA transcript Y57G11C.1067"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           15874..15894
FT                   /locus_tag="Y57G11C.1068"
FT                   /standard_name="Y57G11C.1068"
FT                   /product="Hypothetical RNA transcript Y57G11C.1068"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           80412..80432
FT                   /locus_tag="Y57G11C.1069"
FT                   /standard_name="Y57G11C.1069"
FT                   /product="Hypothetical RNA transcript Y57G11C.1069"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(261943..261963)
FT                   /locus_tag="Y57G11C.1070"
FT                   /standard_name="Y57G11C.1070"
FT                   /product="Hypothetical RNA transcript Y57G11C.1070"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(200726..200746)
FT                   /locus_tag="Y57G11C.1071"
FT                   /standard_name="Y57G11C.1071"
FT                   /product="Hypothetical RNA transcript Y57G11C.1071"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(29273..29293)
FT                   /locus_tag="Y57G11C.1072"
FT                   /standard_name="Y57G11C.1072"
FT                   /product="Hypothetical RNA transcript Y57G11C.1072"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(78103..78123)
FT                   /locus_tag="Y57G11C.1073"
FT                   /standard_name="Y57G11C.1073"
FT                   /product="Hypothetical RNA transcript Y57G11C.1073"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(15462..15482)
FT                   /locus_tag="Y57G11C.1074"
FT                   /standard_name="Y57G11C.1074"
FT                   /product="Hypothetical RNA transcript Y57G11C.1074"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           277836..277856
FT                   /locus_tag="Y57G11C.1075"
FT                   /standard_name="Y57G11C.1075"
FT                   /product="Hypothetical RNA transcript Y57G11C.1075"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           222440..222460
FT                   /locus_tag="Y57G11C.1076"
FT                   /standard_name="Y57G11C.1076"
FT                   /product="Hypothetical RNA transcript Y57G11C.1076"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           194628..194648
FT                   /locus_tag="Y57G11C.1077"
FT                   /standard_name="Y57G11C.1077"
FT                   /product="Hypothetical RNA transcript Y57G11C.1077"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           84874..84894
FT                   /locus_tag="Y57G11C.1078"
FT                   /standard_name="Y57G11C.1078"
FT                   /product="Hypothetical RNA transcript Y57G11C.1078"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           62407..62427
FT                   /locus_tag="Y57G11C.1079"
FT                   /standard_name="Y57G11C.1079"
FT                   /product="Hypothetical RNA transcript Y57G11C.1079"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(101882..101902)
FT                   /locus_tag="Y57G11C.1080"
FT                   /standard_name="Y57G11C.1080"
FT                   /product="Hypothetical RNA transcript Y57G11C.1080"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           282378..282398
FT                   /locus_tag="Y57G11C.1081"
FT                   /standard_name="Y57G11C.1081"
FT                   /product="Hypothetical RNA transcript Y57G11C.1081"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(164459..164479)
FT                   /locus_tag="Y57G11C.1082"
FT                   /standard_name="Y57G11C.1082"
FT                   /product="Hypothetical RNA transcript Y57G11C.1082"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           216097..216117
FT                   /locus_tag="Y57G11C.1083"
FT                   /standard_name="Y57G11C.1083"
FT                   /product="Hypothetical RNA transcript Y57G11C.1083"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(301991..302011)
FT                   /locus_tag="Y57G11C.1084"
FT                   /standard_name="Y57G11C.1084"
FT                   /product="Hypothetical RNA transcript Y57G11C.1084"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(274513..274533)
FT                   /locus_tag="Y57G11C.1085"
FT                   /standard_name="Y57G11C.1085"
FT                   /product="Hypothetical RNA transcript Y57G11C.1085"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           257275..257295
FT                   /locus_tag="Y57G11C.1086"
FT                   /standard_name="Y57G11C.1086"
FT                   /product="Hypothetical RNA transcript Y57G11C.1086"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           120694..120714
FT                   /locus_tag="Y57G11C.1087"
FT                   /standard_name="Y57G11C.1087"
FT                   /product="Hypothetical RNA transcript Y57G11C.1087"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(30284..30304)
FT                   /locus_tag="Y57G11C.1088"
FT                   /standard_name="Y57G11C.1088"
FT                   /product="Hypothetical RNA transcript Y57G11C.1088"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           46036..46056
FT                   /locus_tag="Y57G11C.1089"
FT                   /standard_name="Y57G11C.1089"
FT                   /product="Hypothetical RNA transcript Y57G11C.1089"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(197128..197148)
FT                   /locus_tag="Y57G11C.1090"
FT                   /standard_name="Y57G11C.1090"
FT                   /product="Hypothetical RNA transcript Y57G11C.1090"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           35336..35356
FT                   /locus_tag="Y57G11C.1091"
FT                   /standard_name="Y57G11C.1091"
FT                   /product="Hypothetical RNA transcript Y57G11C.1091"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           91702..91722
FT                   /locus_tag="Y57G11C.1092"
FT                   /standard_name="Y57G11C.1092"
FT                   /product="Hypothetical RNA transcript Y57G11C.1092"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           242770..242790
FT                   /locus_tag="Y57G11C.1093"
FT                   /standard_name="Y57G11C.1093"
FT                   /product="Hypothetical RNA transcript Y57G11C.1093"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(250947..250967)
FT                   /locus_tag="Y57G11C.1094"
FT                   /standard_name="Y57G11C.1094"
FT                   /product="Hypothetical RNA transcript Y57G11C.1094"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           180905..180925
FT                   /locus_tag="Y57G11C.1095"
FT                   /standard_name="Y57G11C.1095"
FT                   /product="Hypothetical RNA transcript Y57G11C.1095"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           254159..254179
FT                   /locus_tag="Y57G11C.1096"
FT                   /standard_name="Y57G11C.1096"
FT                   /product="Hypothetical RNA transcript Y57G11C.1096"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           252583..252603
FT                   /locus_tag="Y57G11C.1097"
FT                   /standard_name="Y57G11C.1097"
FT                   /product="Hypothetical RNA transcript Y57G11C.1097"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119577..119597
FT                   /locus_tag="Y57G11C.1098"
FT                   /standard_name="Y57G11C.1098"
FT                   /product="Hypothetical RNA transcript Y57G11C.1098"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(261830..261850)
FT                   /locus_tag="Y57G11C.1099"
FT                   /standard_name="Y57G11C.1099"
FT                   /product="Hypothetical RNA transcript Y57G11C.1099"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(211029..211049)
FT                   /locus_tag="Y57G11C.1100"
FT                   /standard_name="Y57G11C.1100"
FT                   /product="Hypothetical RNA transcript Y57G11C.1100"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(308512..308532)
FT                   /locus_tag="Y57G11C.1101"
FT                   /standard_name="Y57G11C.1101"
FT                   /product="Hypothetical RNA transcript Y57G11C.1101"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           210228..210248
FT                   /locus_tag="Y57G11C.1102"
FT                   /standard_name="Y57G11C.1102"
FT                   /product="Hypothetical RNA transcript Y57G11C.1102"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(214415..214435)
FT                   /locus_tag="Y57G11C.1103"
FT                   /standard_name="Y57G11C.1103"
FT                   /product="Hypothetical RNA transcript Y57G11C.1103"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           241707..241727
FT                   /locus_tag="Y57G11C.1104"
FT                   /standard_name="Y57G11C.1104"
FT                   /product="Hypothetical RNA transcript Y57G11C.1104"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(51264..51284)
FT                   /locus_tag="Y57G11C.1105"
FT                   /standard_name="Y57G11C.1105"
FT                   /product="Hypothetical RNA transcript Y57G11C.1105"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(271970..271990)
FT                   /locus_tag="Y57G11C.1106"
FT                   /standard_name="Y57G11C.1106"
FT                   /product="Hypothetical RNA transcript Y57G11C.1106"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(94361..94381)
FT                   /locus_tag="Y57G11C.1107"
FT                   /standard_name="Y57G11C.1107"
FT                   /product="Hypothetical RNA transcript Y57G11C.1107"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(167349..167369)
FT                   /locus_tag="Y57G11C.1108"
FT                   /standard_name="Y57G11C.1108"
FT                   /product="Hypothetical RNA transcript Y57G11C.1108"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(195800..195820)
FT                   /locus_tag="Y57G11C.1109"
FT                   /standard_name="Y57G11C.1109"
FT                   /product="Hypothetical RNA transcript Y57G11C.1109"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(26329..26349)
FT                   /locus_tag="Y57G11C.1110"
FT                   /standard_name="Y57G11C.1110"
FT                   /product="Hypothetical RNA transcript Y57G11C.1110"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           12175..12195
FT                   /locus_tag="Y57G11C.1111"
FT                   /standard_name="Y57G11C.1111"
FT                   /product="Hypothetical RNA transcript Y57G11C.1111"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(177601..177621)
FT                   /locus_tag="Y57G11C.1112"
FT                   /standard_name="Y57G11C.1112"
FT                   /product="Hypothetical RNA transcript Y57G11C.1112"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(210532..210552)
FT                   /locus_tag="Y57G11C.1113"
FT                   /standard_name="Y57G11C.1113"
FT                   /product="Hypothetical RNA transcript Y57G11C.1113"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(111868..111888)
FT                   /locus_tag="Y57G11C.1114"
FT                   /standard_name="Y57G11C.1114"
FT                   /product="Hypothetical RNA transcript Y57G11C.1114"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           261348..261368
FT                   /locus_tag="Y57G11C.1115"
FT                   /standard_name="Y57G11C.1115"
FT                   /product="Hypothetical RNA transcript Y57G11C.1115"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           288927..288947
FT                   /locus_tag="Y57G11C.1116"
FT                   /standard_name="Y57G11C.1116"
FT                   /product="Hypothetical RNA transcript Y57G11C.1116"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           228260..228280
FT                   /locus_tag="Y57G11C.1117"
FT                   /standard_name="Y57G11C.1117"
FT                   /product="Hypothetical RNA transcript Y57G11C.1117"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           173670..173690
FT                   /locus_tag="Y57G11C.1118"
FT                   /standard_name="Y57G11C.1118"
FT                   /product="Hypothetical RNA transcript Y57G11C.1118"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           102341..102361
FT                   /locus_tag="Y57G11C.1119"
FT                   /standard_name="Y57G11C.1119"
FT                   /product="Hypothetical RNA transcript Y57G11C.1119"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           119576..119596
FT                   /locus_tag="Y57G11C.1120"
FT                   /standard_name="Y57G11C.1120"
FT                   /product="Hypothetical RNA transcript Y57G11C.1120"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(174859..174879)
FT                   /locus_tag="Y57G11C.1121"
FT                   /standard_name="Y57G11C.1121"
FT                   /product="Hypothetical RNA transcript Y57G11C.1121"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           248873..248893
FT                   /locus_tag="Y57G11C.1122"
FT                   /standard_name="Y57G11C.1122"
FT                   /product="Hypothetical RNA transcript Y57G11C.1122"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(215510..215530)
FT                   /locus_tag="Y57G11C.1123"
FT                   /standard_name="Y57G11C.1123"
FT                   /product="Hypothetical RNA transcript Y57G11C.1123"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(93778..93798)
FT                   /locus_tag="Y57G11C.1124"
FT                   /standard_name="Y57G11C.1124"
FT                   /product="Hypothetical RNA transcript Y57G11C.1124"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           194481..194501
FT                   /locus_tag="Y57G11C.1125"
FT                   /standard_name="Y57G11C.1125"
FT                   /product="Hypothetical RNA transcript Y57G11C.1125"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(299942..299962)
FT                   /locus_tag="Y57G11C.1126"
FT                   /standard_name="Y57G11C.1126"
FT                   /product="Hypothetical RNA transcript Y57G11C.1126"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           3347..3367
FT                   /locus_tag="Y57G11C.1127"
FT                   /standard_name="Y57G11C.1127"
FT                   /product="Hypothetical RNA transcript Y57G11C.1127"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(177826..177846)
FT                   /locus_tag="Y57G11C.1128"
FT                   /standard_name="Y57G11C.1128"
FT                   /product="Hypothetical RNA transcript Y57G11C.1128"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           200046..200066
FT                   /locus_tag="Y57G11C.1129"
FT                   /standard_name="Y57G11C.1129"
FT                   /product="Hypothetical RNA transcript Y57G11C.1129"
FT                   /note="21U RNA gene"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(join(159692..159801,160113..160178))
FT                   /locus_tag="Y57G11C.12c"
FT                   /standard_name="Y57G11C.12c"
FT                   /product="Hypothetical RNA transcript Y57G11C.12c"
FT                   /note="C. elegans non-protein coding RNA nuo-3"
FT                   /ncRNA_class="other"
FT   ncRNA           complement(join(190069..190117,190275..190454,
FT                   190509..190601,190966..191067,191643..191812))
FT                   /locus_tag="Y57G11C.17b"
FT                   /standard_name="Y57G11C.17b"
FT                   /product="Hypothetical RNA transcript Y57G11C.17b"
FT                   /note="C. elegans non-protein coding RNA hhat-2"
FT                   /ncRNA_class="other"
FT   ncRNA           join(62116..62315,62369..62671)
FT                   /locus_tag="Y57G11C.1132"
FT                   /standard_name="Y57G11C.1132"
FT                   /product="Hypothetical RNA transcript Y57G11C.1132"
FT                   /note="C. elegans probable non-coding RNA"
FT                   /ncRNA_class="other"
FT   CDS             join(72323..72434,73344..73819,73988..74092,75390..75609,
FT                   76421..76643,77283..77466)
FT                   /gene="lgc-7"
FT                   /locus_tag="Y57G11C.2"
FT                   /standard_name="Y57G11C.2"
FT                   /product="C. elegans protein Y57G11C.2, partially confirmed
FT                   by transcript evidence"
FT                   /note="C. elegans LGC-7 protein; contains similarity to
FT                   Pfam domains PF02931 (Neurotransmitter-gated ion-channel
FT                   ligand binding domain) , PF02932 (Neurotransmitter-gated
FT                   ion-channel transmembrane region) (2)contains similarity to
FT                   Interpro domains IPR018000 (Neurotransmitter-gated
FT                   ion-channel, conserved site), IPR006201
FT                   (Neurotransmitter-gated ion-channel), IPR006202
FT                   (Neurotransmitter-gated ion-channel ligand-binding),
FT                   IPR006029 (Neurotransmitter-gated ion-channel transmembrane
FT                   region)"
FT                   /db_xref="GOA:O18228"
FT                   /db_xref="HSSP:1OED"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="UniProtKB/TrEMBL:O18228"
FT                   /db_xref="WormBase:WBGene00013300"
FT                   /protein_id="CAB16504.2"
FT                   /translation="MNFYDFKFVFYLAISWCNLLEVDGITVAEQLKDVLMEGYDSSIRP
FT                   VNNERDILIINISMNTMSVLTLDPAEETINFSSEFILQWKDEFLFWNKSDYNITWLKLK
FT                   ESFLWTPDTTVSTSIDTNYLIDASERYVSVKHDGTVRQSIYAVFTNLCDMNVDKFPYDQ
FT                   QTCMIKMGPWSYTTQEVTCIVGRDIAPNDTDFGDFHGNSEWDFEGIVSSVGETEDPDVN
FT                   FTFSEVHFALTVKRRPQFYVWVLLIPTYIITVVCIFGLFTPTANHGLREERVNLGITTL
FT                   LSSAVILQIVANAMPKTSELPLLGNFILAEIFVVAIGVLFAVLVLTLHQRAHTREWRPP
FT                   AWMLWILRMTGSSKFLSRNITKIRHKSSTAERIHYTGEGAYLFKNLDESLQSVREYIQE
FT                   EDRDYFRELTYVKFFDRLDFLLLFIFQVGNALVTLFLVKQ"
FT   CDS             complement(join(128556..128768,128823..129069,
FT                   129170..129384))
FT                   /locus_tag="Y57G11C.4"
FT                   /standard_name="Y57G11C.4"
FT                   /product="C. elegans protein Y57G11C.4, partially confirmed
FT                   by transcript evidence"
FT                   /note="contains similarity to Pfam domain PF05008 Vesicle
FT                   transport v-SNARE protein contains similarity to Interpro
FT                   domains IPR000727 (Target SNARE coiled-coil region),
FT                   IPR007705 (Vesicle transport v-SNARE)"
FT                   /db_xref="GOA:O18230"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="UniProtKB/TrEMBL:O18230"
FT                   /db_xref="WormBase:WBGene00013302"
FT                   /protein_id="CAB16506.2"
FT                   /translation="MSNQSATVEQLSGFEKQYSLQTAEITSKIGRVHTLPSSDRAGAVQ
FT                   EIRKSLEEVNDLLDQMELVVRELESNTTERTKYELRVRSYQSDKKQLDTELEKAIKRVR
FT                   EEADRDELLAFDDQLDEHRQEDQLIANTQRLERSTRKVQDAHRIAVETEQIGAEMLSNL
FT                   ASQRETIGRSRDRLRQSNADLGRANKTLSSMIRRAIQNRLLLLIVTFLLSFMFLYIVYK
FT                   AI"
FT   CDS             complement(join(121147..121290,121344..122107,
FT                   122948..123254,123301..123520,123611..123624))
FT                   /locus_tag="Y57G11C.6"
FT                   /standard_name="Y57G11C.6"
FT                   /product="C. elegans protein Y57G11C.6, partially confirmed
FT                   by transcript evidence"
FT                   /note="contains similarity to Pfam domain PF00102
FT                   Protein-tyrosine phosphatase contains similarity to
FT                   Interpro domains IPR003595 (Protein-tyrosine phosphatase,
FT                   catalytic), IPR000242 (Protein-tyrosine phosphatase,
FT                   receptor/non-receptor type)"
FT                   /db_xref="GOA:O18232"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="UniProtKB/TrEMBL:O18232"
FT                   /db_xref="WormBase:WBGene00013304"
FT                   /protein_id="CAB16508.1"
FT                   /translation="MKNIFGNKNTKRSKNKDGKALASTASKDVADPPKQGGTKGSKKPK
FT                   PSRGNDEKGREPETSAQSKKAKKGKPKRDSKAATPALSPGSREMLSDHKKQTVEDDPPL
FT                   PIATSVAGTVTTTGMPALLPAENATQPLKEVVNSGKKSKGAPNSATATPVSHKSTITEG
FT                   ADKWVGEDVAKNWMDSIDLAEVKKEFEKLQSMKVDVEKECKTWKANSKYNQSEDFPALD
FT                   SNLLKVEKDYVNISRVEIPLGRNIYIGQVPVKDTEETFWKAVFDKRIVSIDVIVGDEPI
FT                   EFFPKKAEDYKNYGQMWINNRKVEYVSDDVFRFSIEVLPHGCSNSIICNVTVISNWKVD
FT                   SVPVKQAIAIKEAFGLNSYLLKAPADDNAMINSQHGAGRAGYFLALAVAVHTIDTKVAE
FT                   PCIVDIVKSIRSQRPRAVDSFCQYCSLYISLLYFIKKKVTKPAEGDKKSTPTNKYLHKK
FT                   SVEMTKQFTNILLEANQPSVMGPQ"
FT   CDS             join(149912..150111,150709..150834,151026..151843,
FT                   152134..152242,152876..152961,153015..153163,
FT                   153218..153391)
FT                   /locus_tag="Y57G11C.9a"
FT                   /standard_name="Y57G11C.9a"
FT                   /product="C. elegans protein Y57G11C.9a, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF00076 RNA
FT                   recognition motif. (a.k.a. RRM, RBD, or RNP domain)
FT                   contains similarity to Interpro domains IPR012677
FT                   (Nucleotide-binding, alpha-beta plait), IPR000504 (RNA
FT                   recognition motif, RNP-1)"
FT                   /db_xref="GOA:Q9U203"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:Q9U203"
FT                   /db_xref="WormBase:WBGene00013307"
FT                   /protein_id="CAB54457.1"
FT                   /translation="MYHNNNYGYNNHRGGGGFRHNNYNNNNNNHHHHYNNLPRINETQV
FT                   PQSKHTIFIRGLHGDISTEEIKEYIGEKVGKISFDFVKVAQDKSKIFVAVRFENRDEAK
FT                   EFMETYSDREFMGCRCDLSWFRDIRRYCAYQRAKQVRSNSQRRRRRSDSQESSKRSASP
FT                   PVRRGRSKSRSRSRSPSRSRSRSRSRSVSRSKSPASRNGRVSRHRSRSQNRSRSRSNTR
FT                   SRSRSSGRSGSAHSRKSDDVDSFDDESFDEKSRVKDNEARQKRRRELSDDDRKDVRETQ
FT                   PKKSVKEELPQIPLPPKTEAAASPSPAPPTPKASKSASFIPPPTADDMELESPPHVSNN
FT                   QYEYQQSNNTYNQIRTGASPVSVSYSVPMEVEATPKMIVRETPQPAQPPVQVNSYYTTT
FT                   PIQQQQQQQQPIPPQLPTALFGHLKAFQSALLSTVKYEPPARKEEDEAGFSTLRLSSLA
FT                   TEDDSADEEKAMVRELKLAKLNDEQMMRFHIKKKQLESAFRNDCETYAVVTRALLAKDE
FT                   SLQFGLKMALLENMEDLYKKMMQRVDDQLDALLVMA"
FT   CDS             join(149912..150111,150709..150834,151026..151843,
FT                   152134..152242,152578..152793,152876..152961,
FT                   153015..153163,153218..153391)
FT                   /locus_tag="Y57G11C.9b"
FT                   /standard_name="Y57G11C.9b"
FT                   /product="C. elegans protein Y57G11C.9b, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF00076 RNA
FT                   recognition motif. (a.k.a. RRM, RBD, or RNP domain)
FT                   contains similarity to Interpro domains IPR012677
FT                   (Nucleotide-binding, alpha-beta plait), IPR000504 (RNA
FT                   recognition motif, RNP-1)"
FT                   /db_xref="GOA:Q9U202"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:Q9U202"
FT                   /db_xref="WormBase:WBGene00013307"
FT                   /protein_id="CAB54458.2"
FT                   /translation="MYHNNNYGYNNHRGGGGFRHNNYNNNNNNHHHHYNNLPRINETQV
FT                   PQSKHTIFIRGLHGDISTEEIKEYIGEKVGKISFDFVKVAQDKSKIFVAVRFENRDEAK
FT                   EFMETYSDREFMGCRCDLSWFRDIRRYCAYQRAKQVRSNSQRRRRRSDSQESSKRSASP
FT                   PVRRGRSKSRSRSRSPSRSRSRSRSRSVSRSKSPASRNGRVSRHRSRSQNRSRSRSNTR
FT                   SRSRSSGRSGSAHSRKSDDVDSFDDESFDEKSRVKDNEARQKRRRELSDDDRKDVRETQ
FT                   PKKSVKEELPQIPLPPKTEAAASPSPAPPTPKASKSASFIPPPTADDMELESPPHVSNN
FT                   QYEYQQSNNTYNQIRTGASPVSVSYSVPMEVEATPKMIVRETPQPAQPPVQVNSYYTTT
FT                   PIQQQQQQQQPIPPQLPTAPPQPPPTTPQPAFVPRQIGRIEIVMPSSLPAPVVSAAAAS
FT                   ASAAAHPVAMNGSAISGGSSMPDITMHPNTNKLFGHLKAFQSALLSTVKYEPPARKEED
FT                   EAGFSTLRLSSLATEDDSADEEKAMVRELKLAKLNDEQMMRFHIKKKQLESAFRNDCET
FT                   YAVVTRALLAKDESLQFGLKMALLENMEDLYKKMMQRVDDQLDALLVMA"
FT   CDS             join(149912..150111,150234..150267)
FT                   /locus_tag="Y57G11C.9c"
FT                   /standard_name="Y57G11C.9c"
FT                   /product="C. elegans protein Y57G11C.9c, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Dictyostelium discoideum
FT                   RecName: Full=Myb-like protein M;; SW:Q55GK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q95Q12"
FT                   /db_xref="WormBase:WBGene00013307"
FT                   /protein_id="CAC42379.1"
FT                   /translation="MYHNNNYGYNNHRGGGGFRHNNYNNNNNNHHHHYNNLPRINETQV
FT                   PQSKHTIFIRGLHGDISTEEINRKREFYPTMC"
FT   CDS             join(160907..161029,161078..161465,161513..161559)
FT                   /gene="arl-8"
FT                   /locus_tag="Y57G11C.13"
FT                   /standard_name="Y57G11C.13"
FT                   /product="C. elegans protein Y57G11C.13, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans ARL-8 protein; contains similarity to
FT                   Pfam domains PF00071 (Ras family) , PF00025
FT                   (ADP-ribosylation factor family) , PF08477 (Miro-like
FT                   protein) contains similarity to Interpro domains IPR006687
FT                   (GTP-binding protein SAR1), IPR003577 (Ras small GTPase,
FT                   Ras type), IPR013684 (MIRO-like), IPR005225 (Small
FT                   GTP-binding protein), IPR001806 (Ras GTPase), IPR003579
FT                   (Ras small GTPase, Rab type), IPR006688 (ADP-ribosylation
FT                   factor), IPR013753 (Ras), IPR006689 (ARF/SAR superfamily)"
FT                   /db_xref="GOA:O18237"
FT                   /db_xref="HSSP:1M2O"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:O18237"
FT                   /db_xref="WormBase:WBGene00000192"
FT                   /protein_id="CAB16514.1"
FT                   /translation="MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQF
FT                   TEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKL
FT                   EASRNELMQLLDKPQLDAIPVLVLGNKKDLPGALDERQLIERMNLSSIQNREICCYSIS
FT                   CKEKENIDITLQWLIDHSKAQR"
FT   CDS             join(162073..162231,163009..163200,163261..163377,
FT                   163422..163523,163573..163731)
FT                   /locus_tag="Y57G11C.14"
FT                   /standard_name="Y57G11C.14"
FT                   /product="C. elegans protein Y57G11C.14, partially
FT                   confirmed by transcript evidence"
FT                   /db_xref="UniProtKB/TrEMBL:O18238"
FT                   /db_xref="WormBase:WBGene00013310"
FT                   /protein_id="CAB16515.1"
FT                   /translation="MECVNCDCTVKTMDNLDKAIRELLQRGKHVNRMMDNEKMIREARR
FT                   MEEVQQLKMQIPKPVDKKPRSSEKNLKLISCEETCMDETLKNSSKPRIIFNKQLGHAES
FT                   IDFDVPSLSYESSDKGVVESTTSTSVSNPKKTTSSSMFTKSEATTISELTTSTFKKAKN
FT                   PSGGALVLDNHYLINNDDGTVSKLPMKIYVKQHLEDGSLDVQLVFFDENSQKVMDISML
FT                   VNGKKIKDVQFCGKDAKLVN"
FT   CDS             complement(join(185567..186070,186185..186750,
FT                   186800..187144,187572..187578))
FT                   /locus_tag="Y57G11C.15"
FT                   /standard_name="Y57G11C.15"
FT                   /product="C. elegans protein Y57G11C.15, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domains PF00344
FT                   (eubacterial secY protein) , PF10559 (Plug domain of
FT                   Sec61p) contains similarity to Interpro domains IPR002208
FT                   (SecY protein), IPR019561 (Translocon Sec61/SecY, plug
FT                   domain)"
FT                   /db_xref="GOA:O18239"
FT                   /db_xref="HSSP:1RH5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="UniProtKB/TrEMBL:O18239"
FT                   /db_xref="WormBase:WBGene00013311"
FT                   /protein_id="CAB16516.1"
FT                   /translation="MGIKFLEFVKPFCGFVPEVSKPERKIQFREKMLWTAITLFVFLVC
FT                   CQIPLFGIMSTDSADPFYWLRVIMASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGD
FT                   TPKDRALFNGAQKLFGMVITVGQAIVYVMSGLYGEPSEIGAGICLLIVVQLVIAGLIVL
FT                   LLDELLQKGYGLGSGISLFIATNICETIVWKAFSPATMNTGRGTEFEGAVIALFHLLAT
FT                   RSDKVRALREAFYRQNLPNLMNLMATFLVFAVVIYFQGFRVDLPIKSARYRGQYSSYPI
FT                   KLFYTSNIPIILQSALVSNLYVISQMLAGKFGGNFFINLLGTWSDNTGYRSYPTGGLCY
FT                   YLSPPESLGHIFEDPIHCIIYIVFMLGSCAFFSKTWIDVSGSSAKDVAKQLKEQQMVMR
FT                   GHREKSMIHELNRYIPTAAAFGGLCIGALSVTADFMGAIGSGTGILLAVTIIYQYFEIF
FT                   VKEQQEMGGVSAMFF"
FT   CDS             join(188427..188528,188575..188763,188919..189092)
FT                   /gene="rps-18"
FT                   /locus_tag="Y57G11C.16"
FT                   /standard_name="Y57G11C.16"
FT                   /product="C. elegans protein Y57G11C.16, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans RPS-18 protein; contains similarity to
FT                   Pfam domain PF00416 Ribosomal protein S13/S18 contains
FT                   similarity to Interpro domains IPR001892 (Ribosomal protein
FT                   S13), IPR018269 (Ribosomal protein S13, conserved site)"
FT                   /db_xref="GOA:O18240"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="UniProtKB/TrEMBL:O18240"
FT                   /db_xref="WormBase:WBGene00004487"
FT                   /protein_id="CAB16517.1"
FT                   /translation="MSLIIPEKFQHIHRVMNTNIDGNRKVPYALTAIKGVGRRFAFVCC
FT                   RKADVDVNKRAGELTEEDFDKIVTIMQNPSQYKIPNWFLNRQKDIKDGKTGQLLSTAVD
FT                   NKLREDLERMKKIRLHRGLRHYWGLRVRGQHTKTTGRKGRTVGVSKKKGG"
FT   CDS             206090..208039
FT                   /locus_tag="Y57G11C.20"
FT                   /standard_name="Y57G11C.20"
FT                   /product="Hypothetical protein Y57G11C.20"
FT                   /note="contains similarity to Trichomonas vaginalis G3
FT                   SubName: Full=Trichohyalin, putative;; TR:A2FV34"
FT                   /db_xref="UniProtKB/TrEMBL:O18244"
FT                   /db_xref="WormBase:WBGene00013315"
FT                   /protein_id="CAB16521.1"
FT                   /translation="MNDFYVTLPSSVKNAQFENTSSRYVTRLPQVLHLEKDEYSVAVTD
FT                   IIYPYSFVNLGRPLNYWIHFKNREPINVTFPAAQYDDLPHVVNSLNGVQKPRMKRGAPL
FT                   ILENEQVKRPKSDEPLSERDVIINKIRELEAKAKKDEEERIAREKEEKNKQREKHLATH
FT                   KKAEEFAKKVQTDKDEQREKHLDTHKKAEQNAQDNQKYHDEERKKHIETQKKAEENEEK
FT                   RRAKEKADRDAHVARHKQAEALEKKKREQEEKQKNEDRERATQKERREHIERHRQAEAR
FT                   AKALEKEKHEQEEKQKKENLERAEKERHDHIERQRQAEARAKALEQEKQEEKQKNEDRE
FT                   RATQKERREHLERHRQAEARAKALEKEKHERLQQEAKDKEDERARDKARKDAKAREEAK
FT                   SREDVKAEKVAIDPKQVVNIPGKVYASQEAKKIIEKVNELEKQERDKIVSKVRESEAIE
FT                   KEAVRASSEYHDVALKIFQKPNDRNIYDELKLSFERIRSRIKVSHFENSSDYLQFGEKD
FT                   GRVSIDFLDSNILFEEFEKSCAYFLGFHDTIVRESSLAPSKIDYFGNVSTIYLYCDIVD
FT                   PIIVGDSKNSLLSVIPCKGKYGEMIHHTIPHPRYLPIMNSTIDSIKIELLSEFAEPINF
FT                   NWGSTVIVLHFKKI"
FT   CDS             209113..209823
FT                   /locus_tag="Y57G11C.21"
FT                   /standard_name="Y57G11C.21"
FT                   /product="C. elegans protein Y57G11C.21, partially
FT                   confirmed by transcript evidence"
FT                   /note="contains similarity to Interpro domain IPR000358
FT                   (Ribonucleotide reductase)"
FT                   /db_xref="GOA:O18245"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="UniProtKB/TrEMBL:O18245"
FT                   /db_xref="WormBase:WBGene00013316"
FT                   /protein_id="CAB16522.1"
FT                   /translation="MIGRMDPKSHDVIVDDLDFSTMPGTQTCIQNSRWTVVNLKNAFQA
FT                   EGPWEFVLGNNSRSYLNLKRTYLVYTFNITDQNGAIVTIPNPITKDSLVYAPINNIAHS
FT                   IVKNFSLHINSQLAYHNFSNYAYKAYFENALMYGKEIKNSTLTAAGYFHEDEIGSPASK
FT                   GFLNRCGTGTTQVAANISLDLMNQPRVLLNSCNVKLTAYPNNSEFLIEAYNHGQQKFKF
FT                   NVTDVYALVNEYSK"
FT   CDS             complement(join(218059..218244,218633..219019,
FT                   219135..219249,219829..219995,220718..220861,
FT                   222602..222884,222933..223015,223063..223154,
FT                   224288..224413,224451..224466))
FT                   /locus_tag="Y57G11C.23"
FT                   /standard_name="Y57G11C.23"
FT                   /product="C. elegans protein Y57G11C.23, partially
FT                   confirmed by transcript evidence"
FT                   /note="contains similarity to Pfam domains PF07690 (Major
FT                   Facilitator Superfamily) (3), PF00083 (Sugar (and other)
FT                   transporter) (2)contains similarity to Interpro domains
FT                   IPR011701 (Major facilitator superfamily MFS-1), IPR005828
FT                   (General substrate transporter)"
FT                   /db_xref="GOA:O18247"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:O18247"
FT                   /db_xref="WormBase:WBGene00013318"
FT                   /protein_id="CAB16524.1"
FT                   /translation="MGCIKVIKGAWRLDIGLMILYQMTLFFSVQMLFVIFLEYMPKTHC
FT                   TEDRYCYKLKNKCMSDFDRHSDSDVCPFASTNFDQCVVAANKTDFYSAQYEYQQDCTGL
FT                   KYFSSSTSTFLGTLVGNLILGYLSDTIGRRPVYIFSILLGVPSVILSAALNDVMSFYIF
FT                   RFLVGFAIAGTLTVGWTYASEMVIPSRRFRLRTFPNWANARMMQVGVSWLAGEWRLASY
FT                   LCAALSATVLPMIWYLPESPVFLEQKKKYKRAERSREKIAGICQLEYEPKAREEMQDLK
FT                   KITPIKLLKSPVLRTNFLVLCWMWFYVGMSVYITDLNSGDMAENFYVGQFLCGLVLTVS
FT                   KIMIGILEPKIPWLGRRCLFISSQIIAILAYITILTALWTRNKVSWWYTVAYILAYAGQ
FT                   SLCLETCYLSLAELMPTDVRTISGALMNILMKIGTILASTTKPIKFWYEPLLFIINTII
FT                   CTGGLIIVWKYLPESKNMNMQLVGQDDIDEDEDDDSNKTEKPSEIPSEATKSVKTSTEA
FT                   TEMESEVETEKSSTS"
FT   CDS             join(282352..282660,282714..283004)
FT                   /gene="ccch-5"
FT                   /locus_tag="Y57G11C.25"
FT                   /standard_name="Y57G11C.25"
FT                   /product="C. elegans protein Y57G11C.25, partially
FT                   confirmed by transcript evidence"
FT                   /note="C. elegans CCCH-5 protein; contains similarity to
FT                   Pfam domain PF00642 Zinc finger C-x8-C-x5-C-x3-H type (and
FT                   similar) contains similarity to Interpro domain IPR000571
FT                   (Zinc finger, CCCH-type)"
FT                   /db_xref="GOA:O18251"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:O18251"
FT                   /db_xref="WormBase:WBGene00013319"
FT                   /protein_id="CAB16528.1"
FT                   /translation="MSNQLAVSDVPTAAWTSQQPRSPRMFDQENGFSQNFQPFMQQNKT
FT                   VNPCTISDDVREEMMRLRRRENAFKTALCKTFQLTKACSYGEQCKFAHSVEELQLKHQN
FT                   LGINNPKYKTVLCDNFSTTGHCKYGTKCQFIHRTVEPASLKIQNPLVPRFPSWFAPPSS
FT                   LAREFLCLNHFEASTSSSTTQKLTSSNLSTSTFRYY"
FT   CDS             join(45774..46253,47048..47127,48533..48835,49496..49652,
FT                   49798..49992)
FT                   /locus_tag="Y57G11C.31"
FT                   /standard_name="Y57G11C.31"
FT                   /product="C. elegans protein Y57G11C.31, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF03407
FT                   Nucleotide-diphospho-sugar transferase contains similarity
FT                   to Interpro domain IPR005069 (Nucleotide-diphospho-sugar
FT                   transferase, predicted)"
FT                   /db_xref="GOA:O18253"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniProtKB/TrEMBL:O18253"
FT                   /db_xref="WormBase:WBGene00013321"
FT                   /protein_id="CAB16530.2"
FT                   /translation="MTESTKSGGGPNLRNLLYTIWTSTECVLYKVLFNRVTLIAFYAFW
FT                   FLFGVLVLRKTQNAITAVRYVKTHGETVSLSSIEESREFADLIDTLDRKFSRPPAIFLL
FT                   NQYALNMTDNFLCNTATLDGAHERFIFVTLDTVARDTIKKRWPEIQQFHWPTPSLYKPF
FT                   SFAEGPYQTIYLLRSNLALALIKKGKSFWMMQQDTFWRKNIFDMNYEDDMSYDAIFDQL
FT                   GSEEEHSMRKEWVNGANFFIRANNDTQLFFERMSEKLAHWYTPDMGIMIQQCHTWKKPV
FT                   CAYIPHNVVYSWEWMFTEQKDPPYLMQLDCETDGGSKLMQLGRYGFHFVNPDGTCNDQK
FT                   VALAKGKMENGTVEVQMSKTLPSWGRLQFKAYWYIVDYMLWTPIIGEYLKPYLAMIGFI
FT                   LMITI"
FT   CDS             join(19817..19921,19977..20066,20123..20188,20244..20432,
FT                   20485..20568)
FT                   /locus_tag="Y57G11C.33"
FT                   /standard_name="Y57G11C.33"
FT                   /product="C. elegans protein Y57G11C.33, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF10256 Golgin
FT                   subfamily A member 7/ERF4 family contains similarity to
FT                   Interpro domain IPR019383 (Golgin subfamily A member
FT                   7/ERF4)"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:Q9U204"
FT                   /db_xref="WormBase:WBGene00013323"
FT                   /protein_id="CAB54456.2"
FT                   /translation="MAQKPGTMAQMRNGTSGGDKRQYETEVIILNQCRKLNGQIFIQRD
FT                   YSKGLDVQFEAEYPARLTEKVPRDVWENTIVRINRIFADAEAITPQTIFETVLGCFTCY
FT                   ASYAITKSTYRRKLDELQEFLNRENREIYHHVGFHIRNPMERGLRVLEISLLSRQGETP
FT                   RDDVDSPGGAIRTI"
FT   CDS             complement(join(134352..134622,134672..134807,
FT                   134973..135096,135153..135764))
FT                   /locus_tag="Y57G11C.36"
FT                   /standard_name="Y57G11C.36"
FT                   /product="C. elegans protein Y57G11C.36, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF00013 KH domain
FT                   contains similarity to Interpro domains IPR018111 (K
FT                   Homology, type 1, subgroup), IPR004087 (K Homology)"
FT                   /db_xref="GOA:Q8I4C4"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8I4C4"
FT                   /db_xref="WormBase:WBGene00013325"
FT                   /protein_id="CAD56258.1"
FT                   /translation="MSSSADSLTDGIQLLRLAEKHQHSSLLTPPPSDDSQKSLKSTSNH
FT                   SDQEMSKNLHDVEAYIDALKGEKHQLAQYSSGGFNHVFNLIDKEIQKVGGNDAHDGGSQ
FT                   MSGDGSMLTETIMVPVEKFPDYNFVGRLLGPRGTTAKQLEVTTGCRITILGRTKRDGSS
FT                   SNPDVTTGPLRVQISVPADMPQAAKLLKGGVGHIQAILDVPTDGNDELKRQQLLILANM
FT                   NGTYQPRGSATSPGSGDYGHPFQNLLPYGYRLPGNSPSHHESKNDCYNPKCAMMRSFIE
FT                   HSNNNHSSMQKMDDVFHMMHMYELMNRVRIANSHLFGRPEDISKAQEIGNRMCSSINAP
FT                   RARSSNSTTTTTTTLPPRRFFNTKPRPSYQANNESNNANK"
FT   CDS             join(225237..225378,226086..226299,228439..228578,
FT                   228768..228823,229847..229958,230008..230130,
FT                   231093..231205,232413..232466)
FT                   /locus_tag="Y57G11C.38"
FT                   /standard_name="Y57G11C.38"
FT                   /product="C. elegans protein Y57G11C.38, confirmed by
FT                   transcript evidence"
FT                   /db_xref="UniProtKB/TrEMBL:Q8I4C2"
FT                   /db_xref="WormBase:WBGene00013327"
FT                   /protein_id="CAD56260.1"
FT                   /translation="MKIFLFLFLIVPTVKASVICYECHANSTEQGKYCSIDKLCAGTSC
FT                   FFQLNSDNSWSAGCSSTLSSSANISCSAASTSSSIKSTCSCNSDFCNSLAKSKSALSVG
FT                   TRGNGWWGPRPNTQQNITVNLTLPDRNLVHCEECGSVTVGNTTIQIPCDHDHTCQGNYC
FT                   VSVRGQTPYSYCGGVWDRDTGSACKSNGLEPEVCTCSMNMCNVLLDPAPLMTTPVMNDP
FT                   TLLTLATIALGDETAVTPAIIIPEPQPTVGTPVTTVKPTTKRKCKNAKLSPNDQAVFMG
FT                   EKLKNLILGGFGSEDGAVQNFEDDINDHICNYSEDE"
FT   CDS             join(483..675,2616..2734,3044..3187,3772..3960)
FT                   /locus_tag="Y57G11C.39"
FT                   /standard_name="Y57G11C.39"
FT                   /product="C. elegans protein Y57G11C.39, partially
FT                   confirmed by transcript evidence"
FT                   /note="contains similarity to Pfam domain PF02520 Domain of
FT                   unknown function DUF148 contains similarity to Interpro
FT                   domain IPR003677 (Protein of unknown function DUF148)"
FT                   /db_xref="InterPro:IPR003677"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI8"
FT                   /db_xref="WormBase:WBGene00013328"
FT                   /protein_id="CAE18022.1"
FT                   /translation="MFLFFLLPVFSLAAVIQSFTIGVSTELPTVTTVAPVAQVEPITVP
FT                   TRTQNTYNAKIEQRLPFLRGIDELNRQEFFSIIQNDKLSKSEIWENVEKWSEKQTAGVR
FT                   ADIMEFHQRLSHHVDNSKFRVERIIKNLPEALRKLSEIVQDIDITRLQEKNRIANLYTS
FT                   LEDDVSKTLQWIVHLVSYEKNEGKQLERRNKLRKLKKGGIWTGGVQATNII"
FT   CDS             complement(join(65949..66191,66593..66781,66832..66945))
FT                   /locus_tag="Y57G11C.40"
FT                   /standard_name="Y57G11C.40"
FT                   /product="C. elegans protein Y57G11C.40, confirmed by
FT                   transcript evidence"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI7"
FT                   /db_xref="WormBase:WBGene00013329"
FT                   /protein_id="CAE18023.1"
FT                   /translation="MSFFFQFSIVFLVFSGVFAQPTHEECREELKRAVDCAKIVSPSIY
FT                   EFTDEKTFQENKKTVEQSRKCTGELQCDVTKSIVKMDSAKLEFVEKLSKINWCTGNNVY
FT                   SKVKQQCAKSTKAAKQSCSSYSEFVTCIEENLAKQPSCTQEDVEKFKTFSNLIIEICNL
FT                   KMDHIKAFSDFKKADFIQ"
FT   CDS             complement(join(68380..68622,68732..68920,68962..69075))
FT                   /locus_tag="Y57G11C.41"
FT                   /standard_name="Y57G11C.41"
FT                   /product="C. elegans protein Y57G11C.41, partially
FT                   confirmed by transcript evidence"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI6"
FT                   /db_xref="WormBase:WBGene00013330"
FT                   /protein_id="CAE18024.1"
FT                   /translation="MSFFIYLLIFALFLGVFGVQPTHEECKIERKKLERCNNNLATRIS
FT                   DIVDNKAFLPNRKSIEEVQTCVGVLHCDLTKSYMKFKSTEMEFAEKMNEIYSCTGSGVY
FT                   TYISQECADITGVKDESCFKFGEFQDCIEKNIEKTPRCTKSDAEKFKTFSNLIGQMCQN
FT                   NVELAKDIKAFNKANLVQ"
FT   CDS             join(132303..132387,132442..132838,132892..132997,
FT                   133045..133365)
FT                   /locus_tag="Y57G11C.43"
FT                   /standard_name="Y57G11C.43"
FT                   /product="C. elegans protein Y57G11C.43, partially
FT                   confirmed by transcript evidence"
FT                   /note="contains similarity to Pfam domain PF08433 Chromatin
FT                   associated protein KTI12 contains similarity to Interpro
FT                   domain IPR013641 (Chromatin associated protein KTI12)"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI4"
FT                   /db_xref="WormBase:WBGene00013332"
FT                   /protein_id="CAE18026.1"
FT                   /translation="MPLIIVTGHPSSGKSTVVDRLAKKFEEKGKDYLIIRDEDYGGFDR
FT                   KNYEFSNKEKDLRSWIRSQVQQNLTKNKVIICDALNYIKGYRYELFLAAKMSKTTYCVV
FT                   ECSPPVATCHWLNEQKPEVERYPKEIIDQLMMRYERPDTKLRWEKPLFEVKIGTAEKAT
FT                   PVDFDEDMAIDLEHPAPRFASIFEDEIVEWICNGTELTENQSTQTVPLAPTNFLHELDR
FT                   STQDVVTVLLNAQRTAVRGQNLTIPGATDGANTIKFMKLRTLPELNRLRHQFVNMSKKD
FT                   PTTDKEKIITGFVDFLNCNLR"
FT   CDS             complement(join(133428..133457,133505..133603,
FT                   133669..133785,133838..133916,133972..134114))
FT                   /locus_tag="Y57G11C.44"
FT                   /standard_name="Y57G11C.44"
FT                   /product="C. elegans protein Y57G11C.44, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Pfam domain PF00858
FT                   Amiloride-sensitive sodium channel contains similarity to
FT                   Interpro domain IPR001873 (Na+ channel,
FT                   amiloride-sensitive)"
FT                   /db_xref="GOA:Q7YTI3"
FT                   /db_xref="InterPro:IPR001873"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI3"
FT                   /db_xref="WormBase:WBGene00013333"
FT                   /protein_id="CAE18027.1"
FT                   /translation="MSEVRQRKSSIIDSDLDFSDSDGEFKEIIKDIENDQWKDKPVDET
FT                   RWSKTKSAVHEWGLSCSWHGIPHMAQSLSWPTILLWTTLLIISAVLFVYLITVTVRQYF
FT                   SFQKLVNLNIGMVESNFPSITFCNTNPYKLSAVRAIPELEALLTVYSQAYT"
FT   CDS             complement(join(175869..176102,176514..176697,
FT                   177461..177657,177704..177819,178574..178676,
FT                   178721..178867,178962..179114))
FT                   /locus_tag="Y57G11C.46"
FT                   /standard_name="Y57G11C.46"
FT                   /product="C. elegans protein Y57G11C.46, partially
FT                   confirmed by transcript evidence"
FT                   /note="contains similarity to Pfam domains PF10292
FT                   (Serpentine type 7TM GPCR receptor class ab chemoreceptor)
FT                   , PF02175 (Serpentine type 7TM GPCR chemoreceptor Srb)
FT                   contains similarity to Interpro domains IPR019408 (7TM
FT                   GPCR, serpentine chemoreceptor, Srab), IPR002184 (7TM GPCR
FT                   , serpentine receptor class b (Srb), Nematode)"
FT                   /db_xref="InterPro:IPR019408"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI1"
FT                   /db_xref="WormBase:WBGene00013335"
FT                   /protein_id="CAE18029.1"
FT                   /translation="MTTYTTSTRSPTTVISVNSSTSISTIVAGINCDTVDYVQRYYPIA
FT                   MMQIILLILSFSSIFLIIGGRIAQHHSYFHPNVKKLLKTYHGAILMYGVSLGTAQLYHV
FT                   MTSMSYESCELLISCRLCFGFRVIATATVLIFCLLLFAIPFERSIATQHLGRGYENRKG
FT                   SIGKWFSWSTVTVSLVFSICYHWSDFSKNRVCTHCIYDQNRVLIPMELMIWLTGMSISS
FT                   LIYTFGLWIFNRCKLKKKTYSLAIEFQINQNLRILHLVLPLSLLTSLAFIWYSISPKWF
FT                   KISMDIDPEKKQFHEMVQNIFPLYTLLSSSLWLVMMISEKKKKRIGLVPPEARKDEKDV
FT                   YFKSLDNQWSKVPSQKPSVKMQILTVFSTPRNSMIVA"
FT   CDS             complement(join(267792..267842,268288..268411,
FT                   268558..268698,269324..269412,270387..270449,
FT                   270885..271115,271792..271923,272122..272241))
FT                   /gene="pnc-2"
FT                   /locus_tag="Y57G11C.47"
FT                   /standard_name="Y57G11C.47"
FT                   /product="C. elegans protein Y57G11C.47, partially
FT                   confirmed by transcript evidence"
FT                   /note="C. elegans PNC-2 protein; contains similarity to
FT                   Pfam domain PF00857 Isochorismatase family contains
FT                   similarity to Interpro domain IPR000868
FT                   (Isochorismatase-like)"
FT                   /db_xref="GOA:Q7YTI0"
FT                   /db_xref="HSSP:1IM5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTI0"
FT                   /db_xref="WormBase:WBGene00013336"
FT                   /protein_id="CAE18030.1"
FT                   /translation="MGVVQNEQDIREKMKNELISLVNEIDLIPELDRLLDDFIENKTWN
FT                   EDTQELFTRVVLKPFTTLRTSLLVVDFQNDFVTGSLSIKEGDAEQDPLEALPHVNNLLE
FT                   NLNWNMIVYTQDWHPSNHISFFEHARNPDRELAPEDKSRKLRPFDIVRFVKPVSTIQVL
FT                   YPSHCIQGGWGSQLHLGLQRIDGAHYIKKGADVYVDAYSAFSDNCGIKQSELEMLLRKN
FT                   DINAVIGCGLAYDICVMHTLKDASKHGFLTCIVKSGSKGLSSLKMDEANKMFQKRGVAI
FT                   IDDEMAQLISRREAFPIEWIRLLVHQAQSELHGKK"
FT   CDS             complement(join(56761..57675,59595..60373,62462..62669))
FT                   /gene="haf-8"
FT                   /locus_tag="Y57G11C.1"
FT                   /standard_name="Y57G11C.1"
FT                   /product="C. elegans protein Y57G11C.1, partially confirmed
FT                   by transcript evidence"
FT                   /note="C. elegans HAF-8 protein; contains similarity to
FT                   Pfam domains PF00664 (ABC transporter transmembrane region)
FT                   (2), PF00005 (ABC transporter) contains similarity to
FT                   Interpro domains IPR003439 (ABC transporter-like),
FT                   IPR017871 (ABC transporter, conserved site), IPR001140 (ABC
FT                   transporter, transmembrane region), IPR003593 (ATPase, AAA+
FT                   type, core)"
FT                   /db_xref="GOA:O18227"
FT                   /db_xref="HSSP:1MV5"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:O18227"
FT                   /db_xref="WormBase:WBGene00001818"
FT                   /protein_id="CAB16503.1"
FT                   /translation="MRISCSKSVPFSDLININTGAAGEIVDKNDDEEENRLPLSEHLWE
FT                   IVKLCGKQWRWFVPAYTLLILDCALNLIEPALYGQMMTNAIQMKSFDIIKRACLLLALI
FT                   QFSEATCKSACYFFMQYAEKLTARNIRIQLFRSILHQEISFFDENKTGQLVSRITHDSE
FT                   SISNTLPVHIETLVNNLFMFFGSIPIMFCYSWQLTLTSFIEFPITLLMTRYYGLAVEKL
FT                   SEKENDATAASNETVEEVLSAIRTVRSFAAENFEQKRYTKNTEDWFKISTKTVTLGTIY
FT                   NYFWALMLRSQDVIRYLYGGYLALNGRMAPEALLTFIFYHWRLHTAINAFSSLFSGVMK
FT                   TIGLSRKVIHLINRKPQLDYDFGTETPEIQGKIEFEVVEFAYPTRKTVNVINGINLSIE
FT                   SGKTVALVGPSGNGKSTLVSLIQQFYTPQSGRILTDGIPIQNINHQHYHSNIALVAQEP
FT                   TLFSGTIRENILFGIENGTEEAMLKAAEMANVHEFVSKMDDGYDTKCGEKGVQMSGGQK
FT                   QRIAIARALIRNPRVLILDEATSALDSESEGMVQEALNKCAKERTVIVIAHRLSTVRKA
FT                   QKIAVIENGSVKEMGCHDELMENQDGLYYKLVSKQLGSIVDTNIFNCFDMLIFFVLF"
FT   CDS             join(78528..78639,79019..79491,79886..79990,81273..81492,
FT                   82078..82300,82985..83168)
FT                   /gene="lgc-8"
FT                   /locus_tag="Y57G11C.49"
FT                   /standard_name="Y57G11C.49"
FT                   /product="Hypothetical protein Y57G11C.49"
FT                   /note="C. elegans LGC-8 protein; contains similarity to
FT                   Pfam domains PF02931 (Neurotransmitter-gated ion-channel
FT                   ligand binding domain) , PF02932 (Neurotransmitter-gated
FT                   ion-channel transmembrane region) (2)contains similarity to
FT                   Interpro domains IPR018000 (Neurotransmitter-gated
FT                   ion-channel, conserved site), IPR006201
FT                   (Neurotransmitter-gated ion-channel), IPR006202
FT                   (Neurotransmitter-gated ion-channel ligand-binding),
FT                   IPR006029 (Neurotransmitter-gated ion-channel transmembrane
FT                   region)"
FT                   /db_xref="GOA:Q6BEQ0"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BEQ0"
FT                   /db_xref="WormBase:WBGene00013338"
FT                   /protein_id="CAH04731.2"
FT                   /translation="MNFHDYKLFLHSVLILWNLLEIDGITVSEQLKDVLMEGYDSSIRP
FT                   VINERDTLFINISINSMSFLTLDPAEETINFSGEFILQWKDEFLFWNKSDYNITWLKLK
FT                   ESFLWTPDTTVSTSIDTNYLIETSERYVSVKYDGTVRQNIYAVFTNLCDMNINEFPYDQ
FT                   QTCMIKMGPWSYTMKEVTCIVGGDIERNETTGKFQGNSEWDFEGIVSSVGETEDPDVNF
FT                   TFSEVHFALTVKRRPQFYVWVLLIPTYIITVVCIFGLFTPTANHGLREERVNLGITTLL
FT                   SSAVILQIVANAMPKTSELPLLGNFILAEIFVVAIGVLFAVLVLTLHQRAHTREWRPPA
FT                   WMLWILRMTGSSKFLSRNITKIRHKSSTAERIHYTGEGAYLFKNLDESLQSVREYIQEE
FT                   DRDYFRELTYVKFFDRLDFLLLLIFQVGNALVTLFLVKQ"
FT   CDS             join(170081..170176,170255..170357,171013..171109,
FT                   171403..171584,172346..172362)
FT                   /locus_tag="Y57G11C.50"
FT                   /standard_name="Y57G11C.50"
FT                   /product="C. elegans protein Y57G11C.50, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Interpro domain IPR013783
FT                   (Immunoglobulin-like fold)"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5WRK9"
FT                   /db_xref="WormBase:WBGene00023520"
FT                   /protein_id="CAH60779.1"
FT                   /translation="MITMGLRETMGRGGPPNTTTFIFLLGCLLFLVSDRYYTCTAENIR
FT                   LKDYKSGNQFSLQITNNKRRSLQQTTPTEQYLNRSSPIAEQGNLHKLHCFFSAYPVPIP
FT                   RWFHNGSEINEDKGYRFESNGNTLVFNATQDKAGKYDCRFATKQDIDRSFNVVVEELQD
FT                   N"
FT   CDS             complement(join(136483..136704,136761..137021))
FT                   /locus_tag="Y57G11C.51"
FT                   /standard_name="Y57G11C.51"
FT                   /product="C. elegans protein Y57G11C.51, confirmed by
FT                   transcript evidence"
FT                   /note="contains similarity to Homo sapiens 14 kDa protein;
FT                   ENSEMBL:ENSP00000405587"
FT                   /db_xref="UniProtKB/TrEMBL:Q564Q2"
FT                   /db_xref="WormBase:WBGene00044258"
FT                   /protein_id="CAI79273.1"
FT                   /translation="MRSQPAQLYDLSKRAIAAKESYKKMSPSKKKEENAKSNANRASRK
FT                   GSGPKKAKPSDAVKRAKEAEKREKKRLSDKKRWEELNDAAKEVVRANAREASARRRAGR
FT                   DAGLSANPKRSPRWSPQPDPSTPSSSTSSSTSSSPSSSSTPLTSTQRRSPRFHAAP"
FT   CDS             complement(join(153866..153952,154010..154263,
FT                   154585..155578))
FT                   /gene="gdi-1"
FT                   /locus_tag="Y57G11C.10a"
FT                   /standard_name="Y57G11C.10a"
FT                   /product="C. elegans protein Y57G11C.10a, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans GDI-1 protein; contains similarity to
FT                   Pfam domain PF00996 GDP dissociation inhibitor contains
FT                   similarity to Interpro domains IPR002005 (Rab GTPase
FT                   activator), IPR000806 (Rab GDI protein), IPR018203 (GDP
FT                   dissociation inhibitor)"
FT                   /db_xref="GOA:Q21449"
FT                   /db_xref="HSSP:1D5T"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniProtKB/TrEMBL:Q21449"
FT                   /db_xref="WormBase:WBGene00001558"
FT                   /protein_id="CAB16511.1"
FT                   /translation="MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESAS
FT                   LTPLEQLYEKFHGPQAKPQQEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFK
FT                   SIEASFVVKGGKIYKVPADEMEALATSLMGMFEKRRFKKFLVWVQQFDENKEDTWQGLD
FT                   PHNSTMQQVYEKFGLDENTADFTGHALALYRDDEHKNQPYAPAVEKIRLYSDSLARYGK
FT                   SPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPVDEIVMENGKAIGVKCGDEIVRGKQI
FT                   YCDPSYAKDRVKKTGQVVRAICLLNHPIPNTNDAQSCQIIIPQKQVGRHYDIYISCCSN
FT                   TNMVTPKGWYLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQISDVYEPSDLGSESQI
FT                   FISQSYDATTHFETTCKDVLNMFERGTTKEFDFTNITHLSLNDQE"
FT   CDS             complement(join(153866..153952,154010..154263,
FT                   154540..155578))
FT                   /gene="gdi-1"
FT                   /locus_tag="Y57G11C.10b"
FT                   /standard_name="Y57G11C.10b"
FT                   /product="C. elegans protein Y57G11C.10b, partially
FT                   confirmed by transcript evidence"
FT                   /note="C. elegans GDI-1 protein; contains similarity to
FT                   Pfam domain PF00996 GDP dissociation inhibitor contains
FT                   similarity to Interpro domains IPR002005 (Rab GTPase
FT                   activator), IPR000806 (Rab GDI protein), IPR018203 (GDP
FT                   dissociation inhibitor)"
FT                   /db_xref="GOA:Q2V4S2"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V4S2"
FT                   /db_xref="WormBase:WBGene00001558"
FT                   /protein_id="CAJ44242.1"
FT                   /translation="MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESAS
FT                   LTPLEQLYEKFHGPQAKPQQEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFK
FT                   SIEASFVVKGGKIYKVPADEMEALATSLMGMFEKRRFKKFLVWVQQFDENKEDTWQGLD
FT                   PHNSTMQQVYEKFGLDENTADFTGHALALYRDDEHKNQPYAPAVEKIRLYSDSLARYGK
FT                   SPYLYPLYGLGELPQGFARLSAIYGGTYMLDKPVDEIVMENGKAIGVKCGDEIVRGKQI
FT                   YCDPSYAKDRVKKTGQVVRAICLLNHPIPNTNDAQSCQIIIPQKQVGRHYGKFIVLEKQ
FT                   RVAQKRDIYISCCSNTNMVTPKGWYLAMVSTTVETANPEAEVLPGLQLLGAIAEKFIQI
FT                   SDVYEPSDLGSESQIFISQSYDATTHFETTCKDVLNMFERGTTKEFDFTNITHLSLNDQ
FT                   E"
FT   CDS             join(242294..242343,248301..248431,249342..249562,
FT                   251107..251334,251938..252061,254192..254502,
FT                   254561..254793,256515..256692,257069..257172,
FT                   257262..257577,257634..257744,258788..258854,
FT                   260049..260233,260348..260429,260858..261014,
FT                   261373..261508,263002..263121)
FT                   /gene="eps-8"
FT                   /locus_tag="Y57G11C.24g"
FT                   /standard_name="Y57G11C.24g"
FT                   /product="C. elegans protein Y57G11C.24g, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans EPS-8 protein; contains similarity to
FT                   Pfam domains PF07653 (Variant SH3 domain) , PF08416
FT                   (Phosphotyrosine-binding domain) (2), PF00018 (SH3 domain)
FT                   contains similarity to Interpro domains IPR013625 (Tensin
FT                   phosphotyrosine-binding domain), IPR001452 (Src homology-3
FT                   domain), IPR011511 (Variant SH3), IPR006020
FT                   (Phosphotyrosine interaction region)"
FT                   /db_xref="GOA:Q6IZD5"
FT                   /db_xref="HSSP:1AOJ"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IZD5"
FT                   /db_xref="WormBase:WBGene00001330"
FT                   /protein_id="CAJ44243.1"
FT                   /translation="MRRGGSMGPPSGDPYQSRPSPGGYYYNRSTPGGQPAPSPSHSQQS
FT                   ASSHHPRGVPMSQPIARRSDYRTGSEQMTPRSDHRGPSMGYGNGGSVDQRVDDVTPSYY
FT                   VEHLATFAVGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDDNGELVE
FT                   QFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAED
FT                   LKNYVQGQFRRVRNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRC
FT                   FDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESE
FT                   FVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPTVAS
FT                   PLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGFAPYGVA
FT                   DRAMATPNQIHRGHSAPPEHFRQPPPRERNMVDTLEFDRLTLERERLEFEKAKIMERES
FT                   RLRHEEKQIEDEKRRMHAEKDLITKETTQPVPPPAAVVTHQPITKRYDPPISISPPPQR
FT                   NNYSHVKVTVDSDTSPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIF
FT                   DERNWWECKNMHQRVGYVPHTILSMVPFEQQQYASPNHHNNSSSTGGYNNGHHQGPAQN
FT                   VYRPPPPPLVSDAGVQVEIRREHVAPPPPPVVIPPPPPPVRTPTMEELLRMQQQQQQKQ
FT                   RKPPVEEPVYQPQPAQRAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRATRVAI
FT                   NEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLL
FT                   VQKKRSGFRTHTGDELKAILNHRRTHVELSNEAAADEPVFTINPIL"
FT   CDS             join(248416..248431,249342..249562,251107..251334,
FT                   251938..252061,254192..254502,254561..254793,
FT                   256515..256692,257069..257172,257262..257577,
FT                   257634..257744,258788..258854,260049..260233,
FT                   260348..260429,260858..261014,261373..261508,
FT                   263002..263121)
FT                   /gene="eps-8"
FT                   /locus_tag="Y57G11C.24a"
FT                   /standard_name="Y57G11C.24a"
FT                   /product="C. elegans protein Y57G11C.24a, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans EPS-8 protein; contains similarity to
FT                   Pfam domains PF07653 (Variant SH3 domain) , PF08416
FT                   (Phosphotyrosine-binding domain) (2), PF00018 (SH3 domain)
FT                   contains similarity to Interpro domains IPR013625 (Tensin
FT                   phosphotyrosine-binding domain), IPR001452 (Src homology-3
FT                   domain), IPR011511 (Variant SH3), IPR006020
FT                   (Phosphotyrosine interaction region)"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013625"
FT                   /db_xref="UniProtKB/TrEMBL:O18250"
FT                   /db_xref="WormBase:WBGene00001330"
FT                   /protein_id="CAB16527.3"
FT                   /translation="MSQPIARRSDYRTGSEQMTPRSDHRGPSMGYGNGGSVDQRVDDVT
FT                   PSYYVEHLATFAVGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDDNG
FT                   ELVEQFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATD
FT                   VAEDLKNYVQGQFRRVRNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNT
FT                   LNRCFDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLP
FT                   LESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAP
FT                   TVASPLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGFAP
FT                   YGVADRAMATPNQIHRGHSAPPEHFRQPPPRERNMVDTLEFDRLTLERERLEFEKAKIM
FT                   ERESRLRHEEKQIEDEKRRMHAEKDLITKETTQPVPPPAAVVTHQPITKRYDPPISISP
FT                   PPQRNNYSHVKVTVDSDTSPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYL
FT                   EVIFDERNWWECKNMHQRVGYVPHTILSMVPFEQQQYASPNHHNNSSSTGGYNNGHHQG
FT                   PAQNVYRPPPPPLVSDAGVQVEIRREHVAPPPPPVVIPPPPPPVRTPTMEELLRMQQQQ
FT                   QQKQRKPPVEEPVYQPQPAQRAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRAT
FT                   RVAINEKSSPEDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLY
FT                   SQLLVQKKRSGFRTHTGDELKAILNHRRTHVELSNEAAADEPVFTINPIL"
FT   CDS             join(242294..242343,248301..248431,249342..249562,
FT                   251107..251334,251938..252061,254192..254502,
FT                   254561..254793,256515..256692,256895..256969,
FT                   257069..257172,257262..257577,257634..257744,
FT                   258788..258928)
FT                   /gene="eps-8"
FT                   /locus_tag="Y57G11C.24h"
FT                   /standard_name="Y57G11C.24h"
FT                   /product="C. elegans protein Y57G11C.24h, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans EPS-8 protein; contains similarity to
FT                   Pfam domains PF07653 (Variant SH3 domain) , PF08416
FT                   (Phosphotyrosine-binding domain) (2), PF00018 (SH3 domain)
FT                   contains similarity to Interpro domains IPR013625 (Tensin
FT                   phosphotyrosine-binding domain), IPR001452 (Src homology-3
FT                   domain), IPR011511 (Variant SH3), IPR006020
FT                   (Phosphotyrosine interaction region)"
FT                   /db_xref="GOA:Q6IZD4"
FT                   /db_xref="HSSP:1AOJ"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IZD4"
FT                   /db_xref="WormBase:WBGene00001330"
FT                   /protein_id="CAJ44244.1"
FT                   /translation="MRRGGSMGPPSGDPYQSRPSPGGYYYNRSTPGGQPAPSPSHSQQS
FT                   ASSHHPRGVPMSQPIARRSDYRTGSEQMTPRSDHRGPSMGYGNGGSVDQRVDDVTPSYY
FT                   VEHLATFAVGRQFGLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDDNGELVE
FT                   QFPLELIEQPTAHVSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAED
FT                   LKNYVQGQFRRVRNGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRC
FT                   FDDIERFVARIQSAALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESE
FT                   FVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPTVAS
FT                   PLLSLEARELMQNCLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGFAPYGVA
FT                   DRAMATPNQIHRGHSAPPEHFRQPPPRERNMVDTAPNTPQSMQRTPKSRPPHRNMSVDN
FT                   LEFDRLTLERERLEFEKAKIMERESRLRHEEKQIEDEKRRMHAEKDLITKETTQPVPPP
FT                   AAVVTHQPITKRYDPPISISPPPQRNNYSHVKVTVDSDTSPRQQAFIDDIVAKGGKLAV
FT                   VTYDRGGQNTKELTVHKGEYLEVIFDERNWWECKNMHQRVGYVPHTILSMVPFEQQQYA
FT                   SPNHHNNSSSTGGYNNGHHQGPGMLPEDAPSYVKERQGKRGEFRYF"
FT   CDS             join(249377..249562,251107..251334,251938..252061,
FT                   254192..254502,254561..254793,256515..256692,
FT                   257069..257172,257262..257577,257634..257744,
FT                   258788..258854,260049..260233,260348..260429,
FT                   260858..261014,261373..261508,263002..263121)
FT                   /gene="eps-8"
FT                   /locus_tag="Y57G11C.24d"
FT                   /standard_name="Y57G11C.24d"
FT                   /product="C. elegans protein Y57G11C.24d, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans EPS-8 protein; contains similarity to
FT                   Pfam domains PF07653 (Variant SH3 domain) , PF08416
FT                   (Phosphotyrosine-binding domain) (2), PF00018 (SH3 domain)
FT                   contains similarity to Interpro domains IPR013625 (Tensin
FT                   phosphotyrosine-binding domain), IPR001452 (Src homology-3
FT                   domain), IPR011511 (Variant SH3), IPR006020
FT                   (Phosphotyrosine interaction region)"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR013625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTG1"
FT                   /db_xref="WormBase:WBGene00001330"
FT                   /protein_id="CAE45095.2"
FT                   /translation="MTPRSDHRGPSMGYGNGGSVDQRVDDVTPSYYVEHLATFAVGRQF
FT                   GLTFPADGIRKLKQMEKNSAIWAQPLILRFRHNAVTVEDDNGELVEQFPLELIEQPTAH
FT                   VSNDSRETYNNVLLFVVREDRKRMSTPTEMHIFQCIRVSATDVAEDLKNYVQGQFRRVR
FT                   NGRRTAAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQS
FT                   AALAQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFN
FT                   LLAKLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPTVASPLLSLEARELMQN
FT                   CLTSHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGFAPYGVADRAMATPNQIHRG
FT                   HSAPPEHFRQPPPRERNMVDTLEFDRLTLERERLEFEKAKIMERESRLRHEEKQIEDEK
FT                   RRMHAEKDLITKETTQPVPPPAAVVTHQPITKRYDPPISISPPPQRNNYSHVKVTVDSD
FT                   TSPRQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFDERNWWECKNMHQ
FT                   RVGYVPHTILSMVPFEQQQYASPNHHNNSSSTGGYNNGHHQGPAQNVYRPPPPPLVSDA
FT                   GVQVEIRREHVAPPPPPVVIPPPPPPVRTPTMEELLRMQQQQQQKQRKPPVEEPVYQPQ
FT                   PAQRAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRATRVAINEKSSPEDVTRWL
FT                   QEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTG
FT                   DELKAILNHRRTHVELSNEAAADEPVFTINPIL"
FT   CDS             join(254194..254502,254561..254793,256515..256692,
FT                   257069..257172,257262..257577,257634..257744,
FT                   258788..258854,260049..260233,260348..260429,
FT                   260858..261014,261373..261508,263002..263121)
FT                   /gene="eps-8"
FT                   /locus_tag="Y57G11C.24e"
FT                   /standard_name="Y57G11C.24e"
FT                   /product="C. elegans protein Y57G11C.24e, confirmed by
FT                   transcript evidence"
FT                   /note="C. elegans EPS-8 protein; contains similarity to
FT                   Pfam domains PF07653 (Variant SH3 domain) , PF00018 (SH3
FT                   domain) contains similarity to Interpro domains IPR001452
FT                   (Src homology-3 domain), IPR011511 (Variant SH3)"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YTG2"
FT                   /db_xref="WormBase:WBGene00001330"
FT                   /protein_id="CAE45094.2"
FT                   /translation="MPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAAL
FT                   AQREIEQQNHRYRTANRRDKKNQQPPDPNGILFMRAQLPLESEFVDILKKFKLSFNLLA
FT                   KLKNHIHEPNAPELLHFLFTPLAVILEACHWGLGRNVAPTVASPLLSLEARELMQNCLT
FT                   SHESDIWMSLGEAWRTPPEDWTKPLPPPYRPIFNDGFAPYGVADRAMATPNQIHRGHSA
FT                   PPEHFRQPPPRERNMVDTLEFDRLTLERERLEFEKAKIMERESRLRHEEKQIEDEKRRM
FT                   HAEKDLITKETTQPVPPPAAVVTHQPITKRYDPPISISPPPQRNNYSHVKVTVDSDTSP
FT                   RQQAFIDDIVAKGGKLAVVTYDRGGQNTKELTVHKGEYLEVIFDERNWWECKNMHQRVG
FT                   YVPHTILSMVPFEQQQYASPNHHNNSSSTGGYNNGHHQGPAQNVYRPPPPPLVSDAGVQ
FT                   VEIRREHVAPPPPPVVIPPPPPPVRTPTMEELLRMQQQQQQKQRKPPVEEPVYQPQPAQ
FT                   RAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRATRVAINEKSSPEDVTRWLQEK
FT                   GFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDEL
FT                   KAILNHRRTHVELSNEAAADEPVFTINPIL"
FT   CDS             complement(join(155938..156135,156188..156348,
FT                   158081..158201,158678..158908,158957..159052))
FT                   /gene="coq-3"
FT