 |
|
EBI DbfetchID Z25536; SV 1; linear; mRNA; STD; PLN; 1158 BP. XX AC Z25536; XX DT 18-AUG-1993 (Rel. 36, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 22) XX DE V.narbonensis (clone pNaF6) mRNA encoding narbonin XX KW 2S storage protein; narbonin. XX OS Vicia narbonensis OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Fabales; Fabaceae; Papilionoideae; Fabeae; Vicia. XX RN [2] RC (sites) RA Hennig M., Pfeffer-Hennig S., Dauter Z., Wilson K.S., Schlesier B., RA Nong V.H.; RT "Crystal-structure of narbonin at 1.8 A resolution"; RL Acta Crystallogr. 51:177-189(1995). XX RN [3] RC (sites) RA Schlesier B., Manteuffel R., Rudolph A., Behlke J.; RT "Studies on seed globulins from legumes. VII. Narbonin, a 2S globulin from RT Vicia narbonensis L."; RL Biochem. Physiol. Pflanz. 173:420-428(1978). XX RN [4] RP 1-1158 RA Nong V.; RT ; RL Submitted (02-AUG-1993) to the EMBL/GenBank/DDBJ databases. RL Nong V., Institut fuer Pflanzengenetik und Kulturpflanzenforschung, RL Molecular Cell Biology, Corrensstrasse 3, Gatersleben, Sachsen-Anhalt, RL Germany, D-06466 XX RN [5] RP 1-1158 RX DOI; 10.1007/BF00042038 RX PUBMED; 7787188. RA Nong V.H., Schlesier B., Bassuener R., Repik A., Horstmann C., Muentz K.; RT "Narbonin, a novel 2S protein from Vicia narbonensis L. seeds: cDNA, gene RT structure and developmentally regulated formation"; RL Plant Mol. Biol. 28(1):61-72(1995). XX FH Key Location/Qualifiers FH FT source 1..1158 FT /organism="Vicia narbonensis" FT /mol_type="mRNA" FT /clone_lib="PCR amplified cDNA" FT /clone="pNaF6" FT /db_xref="taxon:3912" FT CDS 31..906 FT /product="narbonin" FT /function="seed storage protein; other functions unknown" FT /note="Base 31 to 35 are originated from the PCR primer FT designed according to those of clone pNaN21 see also: 5'UTR FT below)." FT /db_xref="GOA:Q41675" FT /db_xref="HSSP:1NAR" FT /db_xref="InterPro:IPR000677" FT /db_xref="InterPro:IPR001223" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="UniProtKB/TrEMBL:Q41675" FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAA80983.1" FT /translation="MPKPIFREYIGVKPNSTTLHDFPTEIINTETLEFHYILGFAIESY FT YESGKGTGTFEESWDVELFGPEKVKNLKRRHPEVKVVISIGGRGVNTPFDPAEENVWVS FT NAKESLKLIIQKYSDDSGNLIDGIDIHYEHIRSDEPFATLMGQLITELKKDDDLNINVV FT SIAPSENNSSHYQKLYNAKKDYINWVDYQFGNQQKPVSTDDAFVEIFKSLEKDYHPHKV FT LPGFSTDPLDTKHNKITRDIFIGGCTRLVQTFSLPGVFFWNANDSVIPKRDGDKPFIVE FT LTLQQLLAKR" FT mat_peptide 34..903 FT /product="seed storage 2S globulin" FT /citation=[2] FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT polyA_signal 934..939 FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT polyA_signal 980..996 FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT 5'UTR 1..30 FT /note="This region is derived from an oligonucleotide FT primer, designed according to the complete 5'UTR plus five FT bases of the coding region of the cDNA clone pNaN21" FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT 3'UTR 907..1158 FT /note="The region from 1115 to 1158 is derived from an FT oligonucleotide primer designed according to the 3'UTR of FT clone pNaC18" FT /citation=[5] FT /experiment="experimental evidence, no additional details FT recorded" FT variation 610 FT /replace="a" FT /note="Replacement of A610 (in pNaC18) with G (in pNaF6) FT led to change of Ser194 to Gly." FT /citation=[5] FT variation 39 FT /replace="a" FT /note="Changes at 39(A to G); 126(A to G); 174(C to T) in FT pNaF6 in compare with pNaN21/pNaC18 are without amino acid FT substitutions." FT /citation=[5] FT variation 126 FT /replace="a" FT /note="Changes at 39(A to G); 126(A to G); 174(C to T) in FT pNaF6 in compare with pNaN21/pNaC18 are without amino acid FT substitutions." FT /citation=[5] FT variation 174 FT /replace="c" FT /note="Changes at 39(A to G); 126(A to G); 174(C to T) in FT pNaF6 in compare with pNaN21/pNaC18 are without amino acid FT substitutions." FT /citation=[5] XX SQ Sequence 1158 BP; 372 A; 236 C; 209 G; 341 T; 0 other; atctcctcct cctcctttca cattgtcaaa atgcctaagc ctatctttcg ggaatacatt 60 ggtgtgaagc caaactcaac aactttacat gattttccaa ctgaaatcat caacacagaa 120 accttggaat tccactacat tttgggcttt gccattgaaa gctattacga aagtggaaaa 180 ggcacaggaa ctttcgagga atcttgggat gttgagttat ttggtccaga aaaagtgaag 240 aatttgaaaa gaaggcatcc agaggtaaag gtggtaataa gcataggagg tcgtggcgtt 300 aacactccat tcgatccagc tgaggaaaat gtatgggttt caaacgctaa agaatcactc 360 aaactgatca tccaaaaata cagtgatgat agcggcaact tgattgatgg cattgacatt 420 cattatgaac acatcagatc ggatgagccg tttgctacgt tgatgggcca acttataaca 480 gaactcaaga aagatgatga cctaaacatc aatgtggtgt cgattgctcc atccgaaaac 540 aactcatccc attaccaaaa attgtataat gcaaagaaag actatatcaa ttgggttgat 600 tatcagttcg gcaatcaaca aaaaccggta tccacagatg atgcctttgt agagatcttt 660 aaaagtttag aaaaagacta ccatcctcat aaagtccttc caggatttag caccgacccg 720 cttgacacta agcataataa aattacacga gatatattca ttggtggctg cacaagactc 780 gtacaaacct tttcactacc tggtgttttt ttctggaacg ctaatgactc cgtcattccc 840 aaacgcgatg gggacaaacc tttcatcgta gagcttacct tgcaacaact cctcgccaaa 900 cgatgagtaa ctcgctatat ctagccagcc agtaataaat ctttcatgtt atgggtcatg 960 catcaaagac tataagctct atatatatta aataagaccc attgtacttc ttttccatct 1020 gtgtttttgt attctgttgt aagtgtggag aattacttct cttgtatctt tcatgttatg 1080 ggtcatgtat cacagactat aagctttata tgctttagcc tttaaaaata ttaaataaga 1140 cccattgtta ttattttc 1158 // |
|