spacer
spacer

EBI Dbfetch

ID   Z25532; SV 1; linear; mRNA; STD; PLN; 1158 BP.
XX
AC   Z25532;
XX
DT   17-AUG-1993 (Rel. 36, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 29)
XX
DE   V.narbonensis (clones pNaN21/pNaC18) mRNA encoding narbonin
XX
KW   2S storage protein; narbonin.
XX
OS   Vicia narbonensis
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
OC   eurosids I; Fabales; Fabaceae; Papilionoideae; Fabeae; Vicia.
XX
RN   [1]
RP   1-1158
RX   DOI; 10.1007/BF00042038
RX   PUBMED; 7787188.
RA   Nong V.H., Schlesier B., Bassuener R., Repik A., Horstmann C., Muentz K.;
RT   "Narbonin, a novel 2S protein from Vicia narbonensis L. seeds: cDNA, gene
RT   structure and developmentally regulated formation";
RL   Plant Mol. Biol. 28(1):61-72(1995).
XX
RN   [2]
RC   (sites)
RA   Hennig M., Pfeffer-Hennig S., Dauter Z., Wilson K.S., Schlesier B.,
RA   Nong V.H.;
RT   "Crystal-structure of narbonin at 1.8 A resolution";
RL   Acta Crystallogr. 51:177-189(1995).
XX
RN   [3]
RC   (sites)
RA   Schlesier B., Manteuffel R., Rudolph A., Behlke J.;
RT   "Studies on seed globulins from legumes. VII. Narbonin, a 2S globulin from
RT   Vicia narbonensis L.";
RL   Biochem. Physiol. Pflanz. 173:420-428(1978).
XX
RN   [4]
RP   1-1158
RA   Nong V.;
RT   ;
RL   Submitted (02-AUG-1993) to the EMBL/GenBank/DDBJ databases.
RL   Nong V., Institut fuer Pflanzengenetik und Kulturpflanzenforschung,
RL   Molecular Cell Biology, Corrensstrasse 3, Gatersleben, Sachsen-Anhalt,
RL   Germany, D-06466
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1158
FT                   /organism="Vicia narbonensis"
FT                   /mol_type="mRNA"
FT                   /dev_stage="Seed, storage deposition stage"
FT                   /clone_lib="PCR amplified cDNA"
FT                   /clone="join: pNaN21 (base 1 to 74) and pNaC18 (base 75 to
FT                   1158)"
FT                   /tissue_type="Cotyledon"
FT                   /db_xref="taxon:3912"
FT   CDS             31..906
FT                   /product="narbonin"
FT                   /function="seed storage protein; other functions: unknown;"
FT                   /note="Base 31 to 74 of pNaN21 overlapped the 5'-end of
FT                   pNaC18 (base 52 to 74, originated from the PCR primer
FT                   designed according to the peptide sequence of the native
FT                   narbonin). "
FT                   /db_xref="GOA:Q08884"
FT                   /db_xref="InterPro:IPR000677"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:1NAR"
FT                   /db_xref="UniProtKB/TrEMBL:Q08884"
FT                   /citation=[1]
FT                   /citation=[2]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA80979.1"
FT                   /translation="MPKPIFREYIGVKPNSTTLHDFPTEIINTETLEFHYILGFAIESY
FT                   YESGKGTGTFEESWDVELFGPEKVKNLKRRHPEVKVVISIGGRGVNTPFDPAEENVWVS
FT                   NAKESLKLIIQKYSDDSGNLIDGIDIHYEHIRSDEPFATLMGQLITELKKDDDLNINVV
FT                   SIAPSENNSSHYQKLYNAKKDYINWVDYQFSNQQKPVSTDDAFVEIFKSLEKDYHPHKV
FT                   LPGFSTDPLDTKHNKITRDIFIGGCTRLVQTFSLPGVFFWNANDSVIPKRDGDKPFIVE
FT                   LTLQQLLAKR"
FT   mat_peptide     34..903
FT                   /product="seed storage 2S globulin"
FT                   /note="The N-terminal Pro and the C-terminal Arg were
FT                   confirmed by peptide sequencing."
FT                   /citation=[1]
FT                   /citation=[2]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   polyA_signal    934..939
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   polyA_signal    980..995
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   polyA_signal    1124..1138
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   5'UTR           1..30
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           907..1158
FT                   /note="The regions from 975 to 1015 and from 1117 to 1158
FT                   are highly homologous and may represent a duplication."
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   misc_feature    52..462
FT                   /note="Total overlapping region of pNaN21 and pNaC18: base
FT                   52 to 462. Thereby, five single-base changes: 189 (G/A);
FT                   255 (A/G); 265 (A/G); 342 (G/A); 348 (A/T). Only change at
FT                   265 replaced Ile79 with Val.  "
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 1158 BP; 375 A; 237 C; 206 G; 340 T; 0 other;
     atctcctcct cctcctttca cattgtcaaa atgcctaaac ctatctttcg ggaatacatt        60
     ggtgtgaagc caaactcaac aactttacat gattttccaa ctgaaatcat caacacagaa       120
     accttagaat tccactacat tttgggcttt gccattgaaa gctattacga aagcggaaaa       180
     ggcacaggaa ctttcgagga atcttgggat gttgagttat ttggtccaga aaaagtgaag       240
     aatttgaaaa gaaggcatcc agaggtaaag gtggtaataa gcataggagg tcgtggcgtt       300
     aacactccat tcgatccagc tgaggaaaat gtatgggttt caaacgctaa agaatcactc       360
     aaactgatca tccaaaaata cagtgatgat agcggcaact tgattgatgg cattgacatt       420
     cattatgaac acatcagatc ggatgagccg tttgctacgt tgatgggcca acttataaca       480
     gaactcaaga aagatgatga cctaaacatc aatgtggtgt cgattgctcc atccgaaaac       540
     aactcatccc attaccaaaa attgtataat gcaaagaaag actatatcaa ttgggttgat       600
     tatcagttca gcaatcaaca aaaaccggta tccacagatg atgcctttgt agagatcttt       660
     aaaagtttag aaaaagacta ccatcctcat aaagtccttc caggatttag caccgacccg       720
     cttgacacta agcataataa aattacacga gatatattca ttggtggctg cacaagactc       780
     gtacaaacct tttcactacc tggtgttttt ttctggaacg ctaatgactc cgtcattccc       840
     aaacgcgatg gggacaaacc tttcatcgta gagcttacct tgcaacaact cctcgccaaa       900
     cgatgagtaa ctcgctatat ctagccagcc agtaataaat ctttcatgtt atgggtcatg       960
     catcaaagac tataagctct atatatatta aataagaccc attgtacttc ttttccatct      1020
     gtgtttttgt attctgttgt aagtgtggag aattacttct cttgtatctt tcatgttatg      1080
     ggtcatgtat cacagactat aagctttata tgctttagcc tttaaaaata ttaaataaga      1140
     cccattgtta ttattttc                                                    1158
//


  
spacer
spacer