 |
|
EBI DbfetchID Z25532; SV 1; linear; mRNA; STD; PLN; 1158 BP. XX AC Z25532; XX DT 17-AUG-1993 (Rel. 36, Created) DT 09-SEP-2004 (Rel. 81, Last updated, Version 29) XX DE V.narbonensis (clones pNaN21/pNaC18) mRNA encoding narbonin XX KW 2S storage protein; narbonin. XX OS Vicia narbonensis OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Fabales; Fabaceae; Papilionoideae; Fabeae; Vicia. XX RN [1] RP 1-1158 RX DOI; 10.1007/BF00042038 RX PUBMED; 7787188. RA Nong V.H., Schlesier B., Bassuener R., Repik A., Horstmann C., Muentz K.; RT "Narbonin, a novel 2S protein from Vicia narbonensis L. seeds: cDNA, gene RT structure and developmentally regulated formation"; RL Plant Mol. Biol. 28(1):61-72(1995). XX RN [2] RC (sites) RA Hennig M., Pfeffer-Hennig S., Dauter Z., Wilson K.S., Schlesier B., RA Nong V.H.; RT "Crystal-structure of narbonin at 1.8 A resolution"; RL Acta Crystallogr. 51:177-189(1995). XX RN [3] RC (sites) RA Schlesier B., Manteuffel R., Rudolph A., Behlke J.; RT "Studies on seed globulins from legumes. VII. Narbonin, a 2S globulin from RT Vicia narbonensis L."; RL Biochem. Physiol. Pflanz. 173:420-428(1978). XX RN [4] RP 1-1158 RA Nong V.; RT ; RL Submitted (02-AUG-1993) to the EMBL/GenBank/DDBJ databases. RL Nong V., Institut fuer Pflanzengenetik und Kulturpflanzenforschung, RL Molecular Cell Biology, Corrensstrasse 3, Gatersleben, Sachsen-Anhalt, RL Germany, D-06466 XX FH Key Location/Qualifiers FH FT source 1..1158 FT /organism="Vicia narbonensis" FT /mol_type="mRNA" FT /dev_stage="Seed, storage deposition stage" FT /clone_lib="PCR amplified cDNA" FT /clone="join: pNaN21 (base 1 to 74) and pNaC18 (base 75 to FT 1158)" FT /tissue_type="Cotyledon" FT /db_xref="taxon:3912" FT CDS 31..906 FT /product="narbonin" FT /function="seed storage protein; other functions: unknown;" FT /note="Base 31 to 74 of pNaN21 overlapped the 5'-end of FT pNaC18 (base 52 to 74, originated from the PCR primer FT designed according to the peptide sequence of the native FT narbonin). " FT /db_xref="GOA:Q08884" FT /db_xref="InterPro:IPR000677" FT /db_xref="InterPro:IPR001223" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="PDB:1NAR" FT /db_xref="UniProtKB/TrEMBL:Q08884" FT /citation=[1] FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAA80979.1" FT /translation="MPKPIFREYIGVKPNSTTLHDFPTEIINTETLEFHYILGFAIESY FT YESGKGTGTFEESWDVELFGPEKVKNLKRRHPEVKVVISIGGRGVNTPFDPAEENVWVS FT NAKESLKLIIQKYSDDSGNLIDGIDIHYEHIRSDEPFATLMGQLITELKKDDDLNINVV FT SIAPSENNSSHYQKLYNAKKDYINWVDYQFSNQQKPVSTDDAFVEIFKSLEKDYHPHKV FT LPGFSTDPLDTKHNKITRDIFIGGCTRLVQTFSLPGVFFWNANDSVIPKRDGDKPFIVE FT LTLQQLLAKR" FT mat_peptide 34..903 FT /product="seed storage 2S globulin" FT /note="The N-terminal Pro and the C-terminal Arg were FT confirmed by peptide sequencing." FT /citation=[1] FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT polyA_signal 934..939 FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT polyA_signal 980..995 FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT polyA_signal 1124..1138 FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT 5'UTR 1..30 FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT 3'UTR 907..1158 FT /note="The regions from 975 to 1015 and from 1117 to 1158 FT are highly homologous and may represent a duplication." FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT misc_feature 52..462 FT /note="Total overlapping region of pNaN21 and pNaC18: base FT 52 to 462. Thereby, five single-base changes: 189 (G/A); FT 255 (A/G); 265 (A/G); 342 (G/A); 348 (A/T). Only change at FT 265 replaced Ile79 with Val. " FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" XX SQ Sequence 1158 BP; 375 A; 237 C; 206 G; 340 T; 0 other; atctcctcct cctcctttca cattgtcaaa atgcctaaac ctatctttcg ggaatacatt 60 ggtgtgaagc caaactcaac aactttacat gattttccaa ctgaaatcat caacacagaa 120 accttagaat tccactacat tttgggcttt gccattgaaa gctattacga aagcggaaaa 180 ggcacaggaa ctttcgagga atcttgggat gttgagttat ttggtccaga aaaagtgaag 240 aatttgaaaa gaaggcatcc agaggtaaag gtggtaataa gcataggagg tcgtggcgtt 300 aacactccat tcgatccagc tgaggaaaat gtatgggttt caaacgctaa agaatcactc 360 aaactgatca tccaaaaata cagtgatgat agcggcaact tgattgatgg cattgacatt 420 cattatgaac acatcagatc ggatgagccg tttgctacgt tgatgggcca acttataaca 480 gaactcaaga aagatgatga cctaaacatc aatgtggtgt cgattgctcc atccgaaaac 540 aactcatccc attaccaaaa attgtataat gcaaagaaag actatatcaa ttgggttgat 600 tatcagttca gcaatcaaca aaaaccggta tccacagatg atgcctttgt agagatcttt 660 aaaagtttag aaaaagacta ccatcctcat aaagtccttc caggatttag caccgacccg 720 cttgacacta agcataataa aattacacga gatatattca ttggtggctg cacaagactc 780 gtacaaacct tttcactacc tggtgttttt ttctggaacg ctaatgactc cgtcattccc 840 aaacgcgatg gggacaaacc tttcatcgta gagcttacct tgcaacaact cctcgccaaa 900 cgatgagtaa ctcgctatat ctagccagcc agtaataaat ctttcatgtt atgggtcatg 960 catcaaagac tataagctct atatatatta aataagaccc attgtacttc ttttccatct 1020 gtgtttttgt attctgttgt aagtgtggag aattacttct cttgtatctt tcatgttatg 1080 ggtcatgtat cacagactat aagctttata tgctttagcc tttaaaaata ttaaataaga 1140 cccattgtta ttattttc 1158 // |
|