 |
|
EBI DbfetchID Z14057; SV 1; linear; genomic DNA; STD; PRO; 3023 BP. XX AC Z14057; XX DT 16-JUL-1992 (Rel. 32, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 7) XX DE B.caldolyticus glgB and glgC genes encoding 1,4-alpha-glucan branching DE enzyme and glucose-1-phosphate adenylyltransferase (partial) XX KW 1,4-alpha-glucan branching enzyme; KW glucose-1-phosphate adenylyl transferase. XX OS Bacillus caldolyticus OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus. XX RN [1] RP 1-3023 RX PUBMED; 1296817. RA Kiel J., Boels J., Beldman G., Venema G.; RT "The glgB gene from the thermophile Bacillus caldolyticus encodes a RT thermolabile branching enzyme"; RL DNA Seq. 3(4):221-232(1992). XX RN [2] RC (sites) RX DOI; 10.1007/BF00290661 RX PUBMED; 1745226. RA Kiel J.A.K.W., Boels J.M., Beldman G., Venema G.; RT "Molecular cloning and nucleotide sequence of the glycogen branching enzyme RT gene (glgB) from Bacillus stearothermophilus and expression in Escherichia RT coli and Bacillus subtilis"; RL Mol. Gen. Genet. 230(1-2):136-144(1991). XX RN [3] RP 1-3023 RA Kiel J.; RT ; RL Submitted (13-JUL-1992) to the EMBL/GenBank/DDBJ databases. RL Kiel J., State University of Groningen, Center of Biol. Sciences, Dept. of RL Genetics, Kerklaan 30, Haren, Groningen, The Netherlands, NL-9751 NN XX FH Key Location/Qualifiers FH FT source 1..3023 FT /organism="Bacillus caldolyticus" FT /mol_type="genomic DNA" FT /clone_lib="plasmid" FT /clone="pKBC3" FT /db_xref="taxon:1394" FT -35_signal 307..317 FT /note="putative -35 region of promoters recognized by the FT Bacillus subtilis RNA polymerase containing the sigma FT factor H." FT /citation=[1] FT -10_signal 331..339 FT /note="Putative -10 region of promoters recognized by the FT Bacillus subtilis RNA polymerase containing the sigma FT factor H." FT /citation=[1] FT RBS 372..385 FT /note="putative ribosome binding site, complementary to 16S FT rRNA of Bacillus subtilis." FT /citation=[1] FT CDS 390..2390 FT /transl_table=11 FT /gene="glgB" FT /standard_name="glycogen branching enzyme" FT /product="1,4-alpha-glucan branching enzyme" FT /function="introduces alpha-1,6-linkages in glycogen FT (starch)" FT /EC_number="2.4.1.18" FT /note="similarity to bacterial and plant branching FT enzymes,and to alpha-amylases,alpha-glucosidases and other FT glucosylases." FT /db_xref="GOA:P30537" FT /db_xref="InterPro:IPR004193" FT /db_xref="InterPro:IPR006047" FT /db_xref="InterPro:IPR006048" FT /db_xref="InterPro:IPR006407" FT /db_xref="InterPro:IPR013780" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR017853" FT /db_xref="UniProtKB/Swiss-Prot:P30537" FT /citation=[1] FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAA78440.1" FT /translation="MIAANPTDLEVYLFHEGRLYQSYELFGAHVIRGGGAVGTRFCVWA FT PHAREVRLVGSFNDWNGTNSPLTKVNDEGVWTIVVPENLEGHLYKYEIITPDGRVLLKA FT DPYAFYSELRPHTASIVYDLKGYEWNDSPWQRKKRRKRIYDQPMVIYELHFGSWKKKPD FT GRFYTYREMADELIPYVLERGFTHIELLPLVEHPLDRSWGYQGTGYYSVTSRYGTPHDF FT MYFVDRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDL FT GKPEVRSFLISNALFWLEYYHVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRQLNEAV FT FAYDPNVWMIAEDSTDWPRVTAPTYDGGLGFNYKWNMGWMNDMLKYMETPPHERKYAHN FT QVSFSLLYAYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKK FT LLFMGSEFAQFDEWKFAEELDWVLFDFELHRKMDEYVKQLIACYKRYKPFYELDHDPRG FT FEWIDVHNAEQSIFSFIRRGKKEGDVLVIVCNFTNQAYDDYKVSVPLLAPYREVLNSDA FT AEFGGSGHVNGKRLPAFSEPFHGKPYHVRMTIPPFGISILRPVQKRGERKQNEEEVHRH FT VIGRRARKPASLADEKHRETSRAVWGEVPDH" FT RBS 2254..2263 FT /note="putative ribosome binding site, complementary to the FT 16S rRNA of Bacillus subtilis." FT /citation=[1] FT CDS 2272..>3023 FT /transl_table=11 FT /gene="glgC" FT /product="glucose-1-phosphate adenylyltransferase" FT /function="synthesis of ADP-glucose from ATP and FT glucose-1-phosphate" FT /EC_number="2.7.7.27" FT /note="similarity to ADP-glucose pyrophosphorylases from FT bacteria and plant." FT /db_xref="GOA:P30522" FT /db_xref="InterPro:IPR005835" FT /db_xref="InterPro:IPR005836" FT /db_xref="UniProtKB/Swiss-Prot:P30522" FT /citation=[1] FT /protein_id="CAA78441.1" FT /translation="MKKKCIAMLLAGGQGSRLRSLTKNIAKPAVPFGGKYRIIDFTLSN FT CTNSGIDTVGVLTQYQPLLLHSYIGIGSAWDLDRRNGGVTVLPPYSASSGVKWYEGTAN FT AIYQNMNYIEQYDPDYVLVLSGDHIYKMDYQQMLDYHIAKQADATISVIEVPWEEASRF FT GIMNTNENMEIVEFAEKPANPKSNLASMGIYIFNWPLLREYLQIDNADPHSSHDFGKDV FT IPRLLRENKRLVAYPFKGYWKDVGTVKS" FT -35_signal complement(237..242) FT /note="putative -35 region of promoters recognized by the FT Bacillus subtilis RNA polymerase containing the sigma FT factor A." FT /citation=[1] FT -10_signal complement(213..218) FT /note="putative -10 region of promoters recognized by the FT Bacillus subtilis RNA polymerase containing the sigma FT factor A." FT /citation=[1] FT RBS complement(178..182) FT /note="putative ribosome binding site, complementary to 16S FT rRNA of Bacillus subtilis." FT /citation=[1] FT CDS complement(<1..171) FT /transl_table=11 FT /gene="ORF" FT /product="unknown" FT /function="putative membrane protein" FT /note="protein with similarity to the putative membrane FT protein encoded by the ORF2 gene located upstream of the FT Bacillus stearothermophilus glgB gene (citation 2)." FT /db_xref="GOA:P55237" FT /db_xref="InterPro:IPR002524" FT /db_xref="UniProtKB/Swiss-Prot:P55237" FT /citation=[1] FT /citation=[2] FT /protein_id="CAA78442.1" FT /translation="MAPTLYDFHHLPHVKTQNESKKALWVTLLLTMFFTAVEIIGGLIS FT NSLALLSDSAHM" XX SQ Sequence 3023 BP; 759 A; 675 C; 834 G; 755 T; 0 other; catatgggcc gaatcggaca agagggcgag tgagttggaa atcagtccgc caatgatttc 60 gacggcggtg aaaaacatgg tcaacaaaag cgtcacccag agcgcttttt tcgattcatt 120 ttgcgttttg acgtgcggga gatggtgaaa atcgtacagt gttggagcca taatgcaact 180 ccattattta taataattat caacttgtat atattataat ataaaaatcc acctgtgtgc 240 aaatgaaatt tcgacagcca gaaacagcgg ttgttggaat tcgtctaaaa atatagacga 300 agcattcaag gaataaagcc ttctgttggc gaataggaat caatgctgtg tatggccatc 360 attttgcttc ggaaaggatg cgatccagct tgattgcggc gaatccgaca gatttagaag 420 tgtatttgtt tcatgaaggc cgtttgtatc aaagttatga gctgttcggc gctcatgtca 480 tccgcggcgg cggagcggtc ggcactcgct tttgcgtgtg ggcgccccat gcgcgggaag 540 tccgtcttgt cggcagtttc aacgattgga atgggacgaa ttcccccctg acgaaggtga 600 acgacgaagg ggtatggacg atcgttgttc cagaaaactt ggaagggcat ctctataaat 660 atgagatcat cacaccggat ggccgtgttc tgttgaaagc ggacccgtac gccttttact 720 ccgaattgcg ccctcatacc gcctcgattg tctacgattt gaaaggatac gagtggaatg 780 attcaccttg gcagcggaag aaacggcgaa agcggattta tgaccaaccg atggtcattt 840 atgaacttca tttcggttcg tggaaaaaga aaccggacgg ccgcttttat acgtaccgtg 900 agatggccga cgaactcatt ccgtacgtgc tggagcgcgg atttacgcac attgagctgc 960 ttccgcttgt cgagcatccg ctcgatcgtt cgtggggata tcaagggacc ggctattatt 1020 cggtgacaag ccgctatggc acgccgcacg atttcatgta tttcgtcgac cgctgccatc 1080 aagcggggct tggcgtcatc atcgactggg tgccggggca tttttgcaag gacgcccacg 1140 ggctgtacat gtttgacggc gcgccgacgt atgaatacgc gaatgaaaaa gaccgagaaa 1200 attacgtctg ggggacggcg aattttgact tgggcaagcc ggaagtgcgc agttttctga 1260 tctccaatgc gttgttttgg ctggagtatt accatgtgga cgggtttcgc gtcgatgcgg 1320 tcgccaatat gctttattgg ccgaacaacg accggctcta tgaaaatccg tatgcggtcg 1380 agtttttgcg ccagttgaat gaggcggtgt ttgcctatga cccgaacgtc tggatgatcg 1440 ctgaagattc gaccgactgg cctcgggtga ccgcgccgac gtacgatggc ggccttgggt 1500 ttaactacaa gtggaacatg ggctggatga acgacatgct gaagtatatg gaaacgccgc 1560 cgcatgagcg gaaatacgcc cataaccaag tcagtttttc cctcctttat gcgtattcgg 1620 aaaatttcat tttgccattt tcccatgatg aagttgtgca tggcaaaaaa tcgctgctca 1680 ataaaatgcc tgggtcgtac gaagagaagt tcgcccagct gcgcctattg tatgggtaca 1740 tgatggccca ccctgggaaa aagctgctgt ttatgggcag tgagtttgcc cagtttgatg 1800 aatggaagtt tgccgaggag ctggactggg tgctgttcga ttttgaattg caccggaaaa 1860 tggacgaata tgtgaagcag ctgatcgcct gctataaacg gtataagccg ttttacgagc 1920 ttgatcatga tccgagaggg tttgaatgga ttgacgttca taatgccgag caaagcattt 1980 tttcattcat ccgccggggg aaaaaagaag gtgatgtgct ggtcattgtt tgtaatttca 2040 caaatcaggc gtatgacgat tacaaagtca gcgtgccgct tttggcgccg taccgcgaag 2100 tgcttaacag cgatgcagcg gagtttggcg gttcgggaca tgtcaacggg aagcggcttc 2160 ccgctttcag tgagccgttt catggaaaac cgtaccatgt gcgcatgacg attccgccgt 2220 ttggcatttc cattttgcgg ccagtgcaaa aacgagggga gagaaagcag aatgaagaag 2280 aagtgcatcg ccatgttatt ggccggcggg caaggaagcc ggcttcgctc gctgacgaaa 2340 aacatcgcga aaccagccgt gccgtttggg gggaagtacc ggatcattga ttttacgttg 2400 agcaattgca cgaactcggg cattgacaca gtcggggtgt tgacccaata tcagccgctt 2460 cttttgcact cgtacatcgg catcggaagc gcatgggatt tagatcgaag aaacgggggc 2520 gtcaccgtcc ttccccctta ctccgcctct tccggcgtca aatggtacga aggcacagcg 2580 aacgccattt atcaaaatat gaattatatt gaacaatacg acccggatta cgttctcgtg 2640 ctgtctggcg atcatattta caagatggat taccagcaga tgctcgacta ccatatcgcc 2700 aaacaggcgg atgcaacgat ttccgttatt gaagtgccgt gggaagaggc gagccgattc 2760 ggcattatga acacgaatga aaacatggaa attgtcgaat ttgccgaaaa gccggccaat 2820 ccgaaaagca atttggcatc gatgggcatt tacattttca attggccgtt attgagggag 2880 tatttgcaaa tcgacaacgc cgatccgcat tcgtcgcacg acttcggcaa agatgtgatt 2940 ccgcggctgc ttcgggagaa caagcggctc gtggcctatc cgttcaaagg ctattggaaa 3000 gatgtcggca ccgtcaaaag ctt 3023 // |
|