![]() |
EBI DbfetchID X64710; SV 1; linear; mRNA; STD; VRT; 1688 BP. XX AC X64710; S46702; XX DT 17-MAR-1992 (Rel. 31, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 5) XX DE G.gallus ODC mRNA for ornithine decarboxylase XX KW ornithine decarboxylase. XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-1688 RA Johnson R.; RT ; RL Submitted (26-FEB-1992) to the EMBL/GenBank/DDBJ databases. RL R. Johnson, AFRC Inst of Animal Physiol and Genetics, Edinburgh Research RL Station, Roslin, Midlothian EH25 9PS, UK XX RN [2] RX PUBMED; 1416246. RA Johnson R., Bulfield G.; RT "Molecular cloning and sequence analysis of a chicken ornithine RT decarboxylase cDNA"; RL Anim. Genet. 23(5):403-409(1992). XX DR Ensembl-Gn; ENSGALG00000000965; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002899; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003837; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003955; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004466; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005774; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006015; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000007151; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000014697; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000016444; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001426; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000004577; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006090; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006306; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000007108; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000009274; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000009679; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000011586; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000026527; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000033989; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000036902; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039644; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..1688 FT /organism="Gallus gallus" FT /strain="Layer (White Leghorn)" FT /mol_type="mRNA" FT /clone_lib="unamplified cDNA library" FT /clone="ODC13" FT /db_xref="taxon:9031" FT CDS <1..1355 FT /codon_start=3 FT /product="ornithine decarboxylase" FT /EC_number="4.1.1.17" FT /db_xref="GOA:P27118" FT /db_xref="InterPro:IPR000183" FT /db_xref="InterPro:IPR002433" FT /db_xref="InterPro:IPR009006" FT /db_xref="UniProtKB/Swiss-Prot:P27118" FT /protein_id="CAA45965.1" FT /translation="FTFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDIVKKHMRW FT HKALPRVTPFYAVKCNDSEAVVKTLAVLGAGFDCASKTEIQLVQSIGVPPERIIYANPC FT KQLSQIKHAANSGVRMMTFDSEVELMKIARPHPKAKLLLRITTDDSKAVCRLSVKFGAT FT LKTSRLLLERAKELDLAIVGVSFHVGSGCTDPETFVQAISDARCVFDMGAELGFNMYLL FT DIGGGFPGSEDVKLKFEEITSVINPALDKYFPLDSEVTIIAEPGRYYVASAFTLAVNII FT AKKIVSKEQTGSDDEDDVNDKTLMYYVNDGVYGSFNCILYDHAHVKPVLQKRPKPDDGC FT YSCSIWGPTCDGLDRIVERCNMPELQVGDWILFENMGAYTVAAASTFNGFQRPTIHYVM FT SRPAWQLMQQIKEQEFLAEVEEQDVASLPLSCACESGIEYPATCASASINV" FT polyA_signal 1358..1363 FT polyA_signal 1680..1685 XX SQ Sequence 1688 BP; 482 A; 320 C; 392 G; 494 T; 0 other; aattcacctt ccttgacgag ggctttactg ccaaggatat cctcgaccaa aaaataaacg 60 aagtgtcatc ttctgatgat aaagatgcct tctatgttgc tgacctcggg gatattgtga 120 agaagcacat gcggtggcat aaagcccttc ctcgagtaac ccccttctac gctgtcaaat 180 gtaatgacag tgaagctgtc gtgaagactc ttgctgttct tggtgcggga tttgattgtg 240 ccagtaagac ggaaatacag ctggttcaga gcatcggtgt acctcctgag cgaataatat 300 atgccaatcc ctgcaaacaa ctatctcaaa tcaaacatgc tgctaacagt ggtgtacgga 360 tgatgacatt tgatagtgaa gtagaactaa tgaaaattgc aaggccccat ccgaaagcca 420 agttactgtt gcgtatcaca actgatgact ccaaagcagt ttgtcgtctc agtgttaaat 480 ttggagctac tctcaagaca agcaggctgc ttctggagcg tgcaaaagag ctggaccttg 540 ccattgtggg agttagcttc catgttggaa gtggatgtac agacccggag acatttgttc 600 aggctatttc cgatgcccgc tgtgtgttcg atatgggagc tgaacttggc ttcaatatgt 660 atctgcttga cattggtggt ggcttccctg gctctgaaga cgtcaagctt aaatttgaag 720 agatcacaag tgtaatcaac ccagcactgg ataaatactt tcctttggat tctgaagtaa 780 ctattattgc agagccagga agatactatg ttgcatcagc attcaccctg gcagtcaata 840 tcattgcaaa aaagattgtg tcaaaggagc agacaggttc tgatgatgaa gatgatgtga 900 atgacaaaac actcatgtat tacgtgaatg atggtgtcta tggatcgttc aattgcatct 960 tgtatgatca tgcacatgtt aaaccagttc tgcaaaagcg gcctaaacca gatgacggct 1020 gctactcctg cagcatatgg ggaccaacgt gtgatggcct ggatcgtatt gttgagcgtt 1080 gtaacatgcc agagttgcaa gttggtgact ggatcctgtt tgaaaacatg ggtgcctata 1140 ctgttgcagc agcttctact ttcaatggat tccagaggcc aacaatacat tatgtgatgt 1200 caagaccagc atggcaatta atgcaacaga taaaggagca ggagttccta gctgaagtgg 1260 aggagcagga tgttgctagt ctgcccctct cctgtgcctg tgaaagtgga attgagtatc 1320 cagcaacttg tgcttcagct agtattaatg tataaataat aaatacttag aaactaactg 1380 caagtttagt cattgaattt agggcatttg ggggaccatt aacttaattc ttgctagaat 1440 tttttaagtg tttttttaaa agtttaggtt tggcataaac acgacaaaaa aatgactagg 1500 agatgggtca catttatctg tgttcctatg gaaactattt gaatattgtt ttatatggat 1560 ttttattcac ttttcatgta tgctaactaa agactgaccc tcagctgtca aacaagtatt 1620 tgtagcttgt gtatggcaga atgggctaag cttagtgttc tgtgacctac ctgttttaaa 1680 ataaaagg 1688 // ![]() |