![]() |
EBI DbfetchID X56891; SV 1; linear; mRNA; STD; PLN; 170 BP. XX AC X56891; XX DT 29-MAR-1993 (Rel. 35, Created) DT 18-APR-2005 (Rel. 83, Last updated, Version 3) XX DE A.hypogaea mRNA for chitinase (chit 1A) XX KW chitinase. XX OS Arachis hypogaea (peanut) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis. XX RN [1] RP 1-170 RX DOI; 10.1007/BF00262442 RX PUBMED; 1980004. RA Herget T., Schell J., Schreier P.H.; RT "Elicitor-specific induction of one member of the chitinase gene family in RT Arachis hypogaea"; RL Mol. Gen. Genet. 224(3):469-476(1990). XX FH Key Location/Qualifiers FH FT source 1..170 FT /organism="Arachis hypogaea" FT /mol_type="mRNA" FT /db_xref="taxon:3818" FT CDS 31..>170 FT /product="chitinase" FT /db_xref="GOA:Q06013" FT /db_xref="InterPro:IPR000726" FT /db_xref="UniProtKB/Swiss-Prot:Q06013" FT /protein_id="CAA40210.1" FT /translation="MTAQGNKPSSHDVITGRWTPSAADKAAGRVSGFGVITNIINGGLD FT CG" XX SQ Sequence 170 BP; 42 A; 47 C; 52 G; 29 T; 0 other; atctcgttca agtcggcgct ctggttgtgg atgacagcac aaggaaacaa gccatcaagc 60 catgatgtca tcaccggaag atggacacca tcggccgcgg acaaggcggc cggccgagtc 120 tccggatttg gagtgatcac gaacatcatc aacggcggcc tggactgcgg 170 // ![]() |