EBI Dbfetch

ID   X02646; SV 1; linear; genomic DNA; STD; FUN; 350 BP.
XX
AC   X02646; K03083;
XX
DT   02-JUL-1986 (Rel. 09, Created)
DT   02-JUL-1986 (Rel. 09, Last updated, Version 1)
XX
DE   Yeast (Pichia pastoris) alcohol oxidase gene 5' end
XX
KW   alcohol oxidase; oxidase.
XX
OS   Pichia pastoris
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Pichia.
XX
RN   [1]
RP   1-350
RX   PUBMED; 3889590.
RA   Ellis S.B., Brust P.F., Koutz P.J., Waters A.F., Harpold M.M.,
RA   Gingeras T.R.;
RT   "Isolation of alcohol oxidase and two other methanol regulatable genes from
RT   the yeast Pichia pastoris";
RL   Mol. Cell. Biol. 5(5):1111-1121(1985).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..350
FT                   /organism="Pichia pastoris"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4922"
FT   misc_feature    133..133
FT                   /note="minor transcription initiation site"
FT   misc_feature    136..136
FT                   /note="major transcription initiation site"
FT   promoter        139..146
FT                   /note="pot. TATA box"
FT   misc_feature    139..139
FT                   /note="minor transcription initiation site"
FT   CDS             250..>350
FT                   /note="alcohol oxidase (aa 1-33) (350 is 2nd base in
FT                   codon)"
FT                   /db_xref="GOA:P04842"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04842"
FT                   /protein_id="CAA26484.1"
FT                   /translation="MAIPEEFDILVLGGGSSGSCIAGRLANLDHSLKV"
XX
SQ   Sequence 350 BP; 105 A; 70 C; 64 G; 111 T; 0 other;
     atgcttccaa gattctggtg ggaatactgc tgatagccta acgttcatga tcaaaattta        60
     actgttctaa cccctacttg acaggcaata tataaacaga aggaagctgc cctgtcttaa       120
     accttttttt ttatcatcat tattagctta ctttcataat tgcgactggt tccaattgac       180
     aagcttttga ttttaacgac ttttaacgac aacttgagaa gatcaaaaaa caactaatta       240
     ttcgaaacga tggctatccc cgaagagttt gatatcctag ttctaggtgg tggatccagt       300
     ggatcctgta ttgccggaag attggcaaac ttggaccact ccttgaaagt                  350
//