 |
|
EBI DbfetchID X02448; SV 1; linear; genomic DNA; STD; PRO; 1361 BP. XX AC X02448; XX DT 28-JAN-1986 (Rel. 08, Created) DT 23-OCT-2008 (Rel. 97, Last updated, Version 4) XX DE Klebsiella aerogenes ribitol (rbt) operon control region XX KW dehydrogenase; inverted repeat; repressor; ribitol. XX OS Klebsiella aerogenes OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Klebsiella. XX RN [1] RP 1-1361 RX PUBMED; 3891331. RA Wu J., Anderton-Loviny T., Smith C.A., Hartley B.S.; RT "Structure of wild-type and mutant repressors and of the control region of RT the rbt operon of Klebsiella aerogenes"; RL EMBO J. 4(5):1339-1344(1985). XX FH Key Location/Qualifiers FH FT source 1..1361 FT /organism="Klebsiella aerogenes" FT /mol_type="genomic DNA" FT /db_xref="taxon:28451" FT CDS complement(<1..204) FT /transl_table=11 FT /note="ribitol dehydrogenase (rbtD) (aa 1-68)" FT /db_xref="GOA:P00335" FT /db_xref="HSSP:1JA9" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/Swiss-Prot:P00335" FT /protein_id="CAA26292.1" FT /translation="MKHSVSSMNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLID FT REGEKLNKLVAELGENAFALQVD" FT RBS complement(211..216) FT /note="ribosome binding site (rbt-D)" FT misc_signal 226..282 FT /note="imp. mirror symmetry M1 (base 254 centre of FT symmetry) pot. transcription regulator (rbt DK)" FT misc_feature 226..226 FT /note="2nd minor transcription initiation site" FT promoter complement(232..237) FT /note="2nd minor -10 region (rbt-D)" FT repeat_region complement(238..249) FT /note="inverted repeat B'" FT repeat_region 254..259 FT /note="imp. direct repeat 1" FT promoter complement(257..262) FT /note="2nd minor -35 region (rbt-D)" FT repeat_region complement(251..262) FT /note="inverted repeat B" FT misc_feature complement(238..262) FT /note="pot. hairpin structure (pot. rbt operator)" FT misc_feature 265..265 FT /note="1st minor transcription initiation site (rbt-D)" FT promoter complement(269..274) FT /note="1st minor -10 region (rbt-D)" FT misc_feature 279..279 FT /note="major transcription initiation site (rbt-D)" FT repeat_region 285..290 FT /note="imp. direct repeat 1" FT promoter complement(283..288) FT /note="major -10 region (rbt-D)" FT misc_feature 292..350 FT /note="imp. mirror symmetry M2 (bases 327/328 centre of FT symmetry)" FT promoter complement(288..293) FT /note="1st minor -35 region (rbt-D)" FT repeat_region 297..301 FT /note="inverted repeat A'" FT repeat_region 300..305 FT /note="imp. direct repeat 1" FT promoter complement(302..307) FT /note="major -35 region (rbt-D)" FT repeat_region complement(316..320) FT /note="inverted repeat A" FT misc_signal complement(297..320) FT /note="pot. hairpin structure (pot. transcription FT regulator) (rbt-D)" FT repeat_region 322..327 FT /note="imp. direct repeat 1" FT misc_feature 327..342 FT /note="cAMP-catabolite repressor protein (CRP) binding FT site" FT misc_feature 355..371 FT /note="cAMP-catabolite repressor protein (CRP) binding FT site" FT promoter 357..362 FT /note="-35 region (rbt-R)" FT misc_feature 366..410 FT /note="pot. hairpin structure (inverted repeat D)" FT repeat_region 366..382 FT /note="inverted repeat D" FT misc_feature 367..410 FT /note="two pot. hairpin structures (inverted repeats C and FT E)" FT repeat_region 367..373 FT /note="imp. inverted repeat C" FT misc_feature 370..426 FT /note="imp. mirror symmetry M3 (base 398-centre of FT symmetry)" FT repeat_region 376..382 FT /note="imp. inverted repeat C'" FT promoter 383..388 FT /note="-10 region (rbt-R)" FT repeat_region 395..410 FT /note="inverted repeat D'" FT repeat_region 395..401 FT /note="imp. inverted repeat E" FT misc_feature 395..395 FT /note="transcription initiation start (rbt-R)" FT repeat_region 404..410 FT /note="imp. inverted repeat E'" FT RBS 448..450 FT /note="ribosome binding site, part 1 (rbt-R)" FT RBS 453..454 FT /note="ribosome binding site, part 2 (rbt-R)" FT CDS 459..1271 FT /transl_table=11 FT /note="repressor protein (rbt-R) (aa 1-270)" FT /db_xref="GOA:P07760" FT /db_xref="HSSP:1LCC" FT /db_xref="InterPro:IPR000843" FT /db_xref="UniProtKB/Swiss-Prot:P07760" FT /protein_id="CAA26293.1" FT /translation="MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIA FT EEQGYAINRQASMLRSKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRR FT RPELEIEAVKAMLSWQVDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDN FT YGGAKALTHKILANSARRRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRI FT FWLPAIRKATLRTACRSGLAARRRCCRGYLLTRRYPWKGLCAGCRRWV" FT misc_feature 1276..1308 FT /note="region of dyad symmetry" FT repeat_region 1276..1287 FT /note="inverted repeat F" FT repeat_region 1295..1308 FT /note="inverted repeat F'" FT misc_signal 1315..1318 FT /note="oligo T stretch (pot. transcription termination FT signal)" XX SQ Sequence 1361 BP; 291 A; 356 C; 421 G; 293 T; 0 other; gtcgacctgc agggcgaagg cgttttcgcc aagttcggcg accagtttgt tgagcttttc 60 gccttcgcgg tcgatcagta ccacttttgc gccagcccca agcagggtcc tcgcgcactc 120 gaggccgata ccggacgccg cgccggtgat cgcggcgact ttaccgctga gggaagtatt 180 catagaggag acagagtgct tcattttata atcctttgcc gtgtctggtt aaaactatcg 240 aacgcgaggg catcacgttc gaggtgatag actaaaactg gtaacatatt gaatatcagc 300 atcttaattc aggcttgctg gcatgttgag gcggtatgcg cgcgtacttc ctggcgtgga 360 aaggatgctc aatcgatgaa gctatgttgc tctcgcttca tcgattgagc aagtggggaa 420 attaacagcg acatgatttt gtgacgcaag ttggaaaaat gaagaagata acgatttacg 480 acctggcgga actttccggc gtttcggcga gcgcggtgag cgctatcctc aacggtaact 540 ggaaaaagcg ccgcatcagc gccaagcttg cggaaaaggt gacgcggatt gccgaggagc 600 agggctatgc gattaaccgt caggccagca tgctgcgcag taaaaaatca cacgtcatcg 660 gtatgattat ccccaaatat gataaccgct acttcggttc catcgccgaa cgctttgagg 720 agatggcccg cgagcgcggc ctgctgccga ttatcacctg tacgcgccgg cgtccggaac 780 tggagatcga agcggtaaag gcgatgctct cctggcaggt tgactgggtg gtcgcgaccg 840 gggcgaccaa tccggataaa atttccgcgc tatgccagca ggcgggcgtg ccaacggtca 900 atctcgacct gccgggctct ctctcgccgt cggtgatttc ggataactac ggcggcgcga 960 aagcgttgac tcataagatc ctggctaata gcgcccgccg ccgcggagag ctggcgccgc 1020 tgacctttat cggcgggcgc agagcgacca taacaccagc gagcgtttac gcggcttcca 1080 cgatgcgcat cgcgagctgg ggcttagcgt gccgcaggcg aatattctgg ctcccggcta 1140 ttcgaaaggc cacgttgagg actgcctgca ggagcggttt ggcagcgaga agacgctgtt 1200 gcaggggata tttgttaact cgacgatatc cctggaaggg gttgtgcgct ggctgtcgca 1260 ggtgggtctg accggcagcg agcagccgcc gatgggctgc ttcgactggg atccttttgt 1320 ctacctgctg gggcacgata tcgacatggt gcagcaggac g 1361 // |
|