![]() |
EBI DbfetchID U67775; SV 1; linear; genomic DNA; STD; VRL; 285 BP. XX AC U67775; XX DT 27-SEP-1996 (Rel. 49, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 7) XX DE Kaposi's sarcoma-associated herpes-like virus vMIP-1B gene, complete cds. XX KW . XX OS Human herpesvirus 8 OC Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Herpesviridae; OC Gammaherpesvirinae; Rhadinovirus. XX RN [1] RP 1-285 RX PUBMED; 9032328. RA Nicholas J., Ruvolo V., Zong J., Ciufo D., Guo H.G., Reitz M.S., RA Hayward G.S.; RT "A single 13-kilobase divergent locus in the Kaposi sarcoma-associated RT herpesvirus (human herpesvirus 8) genome contains nine open reading frames RT that are homologous to or related to cellular proteins"; RL J. Virol. 71(3):1963-1974(1997). XX RN [2] RP 1-285 RX DOI; 10.1038/nm0397-287 RX PUBMED; 9055855. RA Nicholas J., Ruvolo V.R., Burns W.H., Sandford G., Wan X., Ciufo D., RA Hendrickson S.B., Guo H.G., Hayward G.S., Reitz M.S.; RT "Kaposi's sarcoma-associated human herpesvirus-8 encodes homologues of RT macrophage inflammatory protein-1 and interleukin-6"; RL Nat. Med. 3(3):287-292(1997). XX RN [3] RP 1-285 RA Nicholas J.; RT ; RL Submitted (22-AUG-1996) to the EMBL/GenBank/DDBJ databases. RL Johns Hopkins Oncology Center, 418 North Bond Street, Baltimore, MD 21231, RL USA XX FH Key Location/Qualifiers FH FT source 1..285 FT /organism="Human herpesvirus 8" FT /mol_type="genomic DNA" FT /note="Human herpesvirus 8; isolated from body cavity-based FT lymphoma" FT /db_xref="taxon:37296" FT CDS 1..285 FT /codon_start=1 FT /product="vMIP-1B" FT /note="similar to macrophage inflammatory protein-1 (alpha FT and beta)" FT /db_xref="GOA:Q98157" FT /db_xref="InterPro:IPR001811" FT /db_xref="PDB:1CM9" FT /db_xref="UniProtKB/Swiss-Prot:Q98157" FT /protein_id="AAB61702.1" FT /translation="MDTKGILLVAVLTALLCLQSGDTLGASWHRPDKCCLGYQKRPLPQ FT VLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR" XX SQ Sequence 285 BP; 64 A; 76 C; 80 G; 65 T; 0 other; atggacacca agggcatcct gctcgtcgct gtgctgactg ccttgctttg tttgcaatct 60 ggggacacgc tgggagcgtc ctggcataga ccggacaagt gctgtctcgg ttaccagaaa 120 agaccattac cacaggtgct tctgtccagc tggtacccca cctcccaact gtgcagcaag 180 ccgggtgtga tatttttgac aaagcgtggt cgccaggtgt gtgccgacaa atcgaaagac 240 tgggtgaaga agctgatgca gcaattacca gtcactgctc gctga 285 // ![]() |