![]() |
EBI DbfetchID U40716; SV 1; linear; mRNA; STD; MAM; 244 BP. XX AC U40716; XX DT 02-MAR-1996 (Rel. 47, Created) DT 01-OCT-1996 (Rel. 49, Last updated, Version 2) XX DE Felis catus tyrosinase mRNA, partial cds. XX KW . XX OS Felis catus (domestic cat) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae; Felinae; Felis. XX RN [1] RP 1-244 RA der J.S., de Wit M.M.L., van Garderen E., Molenbeek R.F., RA der Velde-Zimmermann D., De Weger R.A.; RT "Cutaneous malignant melanomas in 57 cats; identification of (amelanotic) RT signet-ring and balloon cell types and verification of their origin by RT immunohistochemistry, electron microscopy and in situ hybridisation"; RL Vet. Pathol. 0:0-0(0). XX RN [2] RP 1-244 RA de Wit M.M.L., van Garderen E., vander Linde-Sipman J.S., Velde D., RA De Weger R.A., Tylanus M.; RT ; RL Submitted (15-NOV-1995) to the EMBL/GenBank/DDBJ databases. RL Moniek M.L. de Wit, Veterinary Pathology, Faculty of Veterinary Medicine, RL Utrecht University, Yalelaan 1, Utrecht, 3584 CL, The Netherlands XX FH Key Location/Qualifiers FH FT source 1..244 FT /organism="Felis catus" FT /strain="European shorthair" FT /mol_type="mRNA" FT /tissue_type="melanoma" FT /db_xref="taxon:9685" FT CDS <1..>244 FT /codon_start=3 FT /product="tyrosinase" FT /db_xref="GOA:P55033" FT /db_xref="InterPro:IPR002227" FT /db_xref="UniProtKB/Swiss-Prot:P55033" FT /protein_id="AAB08729.1" FT /translation="LEEYNSRQALCDGTPEGPLLRNPGNHDKARTPRLPSSADVEFCLS FT LTQYESDSMDKAANFSFRNTLEGFASPLTGIADAS" XX SQ Sequence 244 BP; 68 A; 59 C; 58 G; 59 T; 0 other; gattggagga gtacaatagc cgtcaggctt tatgtgatgg aactccagag ggaccattac 60 tgcgcaatcc cggaaaccat gacaaagcca ggaccccaag gctcccctcc tctgctgatg 120 tggaattttg cctaagtctg acacaatatg aatcggattc catggataaa gctgccaatt 180 tcagctttag gaatacactg gaaggatttg ctagtccact tactgggata gcagatgcct 240 ctca 244 // ![]() |