![]() |
EBI DbfetchID U02229; SV 1; linear; genomic DNA; STD; PRO; 333 BP. XX AC U02229; XX DT 13-JAN-1994 (Rel. 38, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 4) XX DE Mycoplasma genitalium random genomic clone xb12, partial cds. XX KW . XX OS Mycoplasma genitalium OC Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma. XX RN [1] RA Peterson S.N.; RT "Characterization and analysis of the Mycoplasma genitalium genome"; RL Thesis (1992), Microbiology and Immunology, University of North Carolina RL Medical School XX RN [2] RP 1-333 RA Peterson S.N., Hu P., Bott K.F., Hutchison C.A.; RT "Survey of the Mycoplasma genitalium genome using random sequencing"; RL Unpublished. XX RN [3] RP 1-333 RA Peterson S.N.; RT ; RL Submitted (27-SEP-1993) to the EMBL/GenBank/DDBJ databases. RL Peterson S.N., University of North Carolina Medical School, Microbiology RL and Immunology, Chapel Hill, NC 27599, USA XX FH Key Location/Qualifiers FH FT source 1..333 FT /organism="Mycoplasma genitalium" FT /isolate="G-37" FT /mol_type="genomic DNA" FT /clone="xb12" FT /db_xref="taxon:2097" FT CDS <1..205 FT /codon_start=2 FT /transl_table=4 FT /product="unknown" FT /function="unknown" FT /db_xref="GOA:P47266" FT /db_xref="HSSP:1AZW" FT /db_xref="InterPro:IPR002410" FT /db_xref="UniProtKB/Swiss-Prot:P47266" FT /protein_id="AAA03381.1" FT /translation="LDNISVLKNKSIYLAHGRFDLICPLYQPLALKQAFPELQLYVTNN FT AGHSGSDANNLATIKHLLKTYL" FT CDS 205..>333 FT /codon_start=1 FT /transl_table=4 FT /note="similar to methionyl-tRNA synthetase M64273" FT /db_xref="GOA:P47267" FT /db_xref="HSSP:1A8H" FT /db_xref="InterPro:IPR014758" FT /db_xref="UniProtKB/Swiss-Prot:P47267" FT /protein_id="AAA03382.2" FT /translation="MKRCYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAF" XX SQ Sequence 333 BP; 111 A; 59 C; 49 G; 114 T; 0 other; tctagataac attagtgttc ttaaaaataa aagtatttat ttggctcatg gtagatttga 60 tctgatctgt cctttatatc aaccattagc attaaaacaa gcattccctg aattacaact 120 ttatgtaacc aataatgctg gtcatagtgg tagtgatgct aataatttag caactataaa 180 acacctttta aaaacttacc tttaatgaag cgttgttata ttacaacccc tatctactac 240 gcatcaggta agccacacat aggtcatgct tttaccacta ttttggcgga tgtaattaag 300 cgttttaaaa tccaaaacgg atatgaggct ttt 333 // ![]() |