![]() |
EBI DbfetchID S72603; SV 1; linear; genomic DNA; STD; PRO; 282 BP. XX AC S72603; XX DT 16-FEB-1993 (Rel. 34, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 5) XX DE gyrA=DNA gyrase A [Staphylococcus epidermidis, Genomic, 282 nt]. XX KW . XX OS Staphylococcus epidermidis OC Bacteria; Firmicutes; Bacillales; Staphylococcus. XX RN [1] RC GenBank staff at the National Library of Medicine created this entry [NCBI RC gibbsq 72603] from the original journal article. This sequence comes from RC 2. RP 1-282 RX PUBMED; 1662027. RA Sreedharan S., Peterson L.R., Fisher L.M.; RT "Ciprofloxacin resistance in coagulase-positive and -negative RT staphylococci: role of mutations at serine 84 in the DNA gyrase A protein RT of Staphylococcus aureus and Staphylococcus epidermidis"; RL Antimicrob. Agents Chemother. 35(10):2151-2154(1991). XX FH Key Location/Qualifiers FH FT source 1..282 FT /organism="Staphylococcus epidermidis" FT /mol_type="genomic DNA" FT /db_xref="taxon:1282" FT CDS 1..282 FT /partial FT /codon_start=1 FT /transl_table=11 FT /gene="gyrA" FT /product="DNA gyrase A" FT /note="Ser-84----Phe mutation confers ciprofloxacin FT resistance. This sequence comes from 2." FT /db_xref="GOA:P0C0Q9" FT /db_xref="HSSP:1AB4" FT /db_xref="InterPro:IPR013758" FT /db_xref="UniProtKB/Swiss-Prot:P0C0Q9" FT /protein_id="AAB20672.1" FT /translation="MAELPQSRINERNITSEMRESFLDYAMSVIVSRALPDVRDGLKPV FT HRRILYGLNEQGMTPDKPYKKSARIVGDVMGKYHPHGDSSIYEAMVRMA" XX SQ Sequence 282 BP; 90 A; 48 C; 59 G; 85 T; 0 other; atggctgaat tacctcaatc aagaattaat gaacgaaata taaccagtga aatgcgtgaa 60 tcattcttag actatgctat gagtgttatc gtttctcgtg cattacctga tgttagagac 120 ggattaaagc cagtacatcg tcgtattctt tatggtttaa atgaacaagg tatgacgccc 180 gataaacctt ataagaaatc tgcacgtata gtcggggatg tcatgggtaa atatcaccct 240 catggtgatt cttcaattta tgaagcaatg gtaagaatgg cc 282 // ![]() |