 |
|
EBI DbfetchID M96793; SV 1; linear; genomic DNA; STD; PRO; 1428 BP. XX AC M96793; XX DT 10-JUL-1992 (Rel. 32, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 11) XX DE Escherichia coli PlsX gene, complete cds and beta-ketoacyl-acyl carrier DE protein synthase III (fabH) gene, 5' end. XX KW beta-ketoacyl-acyl carrier protein synthase III; fabH gene; plsX gene. XX OS Escherichia coli OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. XX RN [1] RP 1-1428 RX PUBMED; 2477362. RA Tanaka Y., Tsujimura A., Fujita N., Isono S., Isono K.; RT "Cloning and analysis of an Escherichia coli operon containing the rpmF RT gene for ribosomal protein L32 and the gene for a 30-kilodalton protein"; RL J. Bacteriol. 171(10):5707-5712(1989). XX RN [2] RP 1-1428 RA Oh W., Larson T.J.; RT "Nucleotide sequence of the plsX gene of Escherichia coli"; RL Unpublished. XX RN [3] RP 1-1428 RX PUBMED; 1551888. RA Tsay J.-T., Oh W., Larson T.J., Jackowski S., Rock C.O.; RT "Isolation and characterization of the beta-ketoacyl-acyl carrier protein RT synthase III gene (fabH) from Escherichia coli K-12"; RL J. Biol. Chem. 267(10):6807-6814(1992). XX FH Key Location/Qualifiers FH FT source 1..1428 FT /organism="Escherichia coli" FT /strain="K-12" FT /mol_type="genomic DNA" FT /db_xref="taxon:562" FT stem_loop 15..38 FT /function="unknown" FT /note="putative" FT /citation=[2] FT variation 79 FT /phenotype="glycerol 3-phosphate auxotrophy when present FT with plsB26" FT /gene="plsX50" FT /standard_name="BB26-36; TL85" FT /replace="cccggc" FT /citation=[2] FT attenuator 91..156 FT /note="attenuator for transcription proceeding from rpmF FT into plsX" FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT stem_loop 91..120 FT /function="unknown" FT /note="putative" FT /citation=[2] FT gene 93..1133 FT /gene="plsX" FT CDS 93..1133 FT /codon_start=1 FT /transl_table=11 FT /gene="plsX" FT /function="fatty acid or phospholipid synthesis" FT /db_xref="GOA:P27247" FT /db_xref="InterPro:IPR003664" FT /db_xref="InterPro:IPR012281" FT /db_xref="UniProtKB/Swiss-Prot:P27247" FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="AAB59064.1" FT /translation="MGGDFGPSVTVPAALQALNSNSQLTLLLVGNSDAITPLLAKADFE FT QRSRLQIIPAQSVIASDARPSQAIRASRGSSMRVALELVKEGRAQACVSAGNTGALMGL FT AKLLLKPLEGIERPALVTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAIMGSVLAEEVV FT EIPNPRVALLNIGEEEVKGLDSIRDASAVLKTIPSINYIGYLEANELLTGKTDVLVCDG FT FTGNVTLKTMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNPDQYNG FT ACLLGLRGTVIKSHGAANQRAFAVAIEQAVQAVQRQVPQRIAARLESVYPAGFELLDGG FT KSGTLR" FT attenuator 121..146 FT /gene="plsX" FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT gene 1201..1428 FT /gene="fabH" FT CDS 1201..>1428 FT /codon_start=1 FT /transl_table=11 FT /gene="fabH" FT /product="beta-ketoacyl-acyl carrier protein synthase III" FT /function="fatty acid synthesis" FT /db_xref="GOA:P0A6R0" FT /db_xref="InterPro:IPR004655" FT /db_xref="InterPro:IPR013747" FT /db_xref="InterPro:IPR013751" FT /db_xref="InterPro:IPR016038" FT /db_xref="InterPro:IPR016039" FT /db_xref="PDB:1EBL" FT /db_xref="PDB:1HN9" FT /db_xref="PDB:1HND" FT /db_xref="PDB:1HNH" FT /db_xref="PDB:1HNJ" FT /db_xref="PDB:1HNK" FT /db_xref="PDB:1MZS" FT /db_xref="PDB:2EFT" FT /db_xref="PDB:2GYO" FT /db_xref="PDB:3IL9" FT /db_xref="UniProtKB/Swiss-Prot:P0A6R0" FT /citation=[3] FT /citation=[2] FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="AAB59065.1" FT /translation="MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIA FT APNETVSTMGFEAATRAIEMAGIEKDQIGLI" XX SQ Sequence 1428 BP; 351 A; 337 C; 410 G; 330 T; 0 other; aagcttagtg aggattttcc ccaggcaact ggggaaagac caaaccgggc ggcgacgata 60 ccttgacacg tctaaccctg gcgttagatg tcatgggagg ggattttggc ccttccgtga 120 cagtgcctgc agcattgcag gcactgaatt ctaattcgca actcactctt cttttagtcg 180 gcaattccga cgccatcacg ccattacttg ctaaagctga ctttgaacaa cgttcgcgtc 240 tgcagattat tcctgcgcag tcagttatcg ccagtgatgc ccggccttcg caagctatcc 300 gcgccagtcg tgggagttca atgcgcgtgg ccctggagct ggtgaaagaa ggtcgagcgc 360 aagcctgtgt cagtgccggt aataccgggg cgctgatggg gctggcaaaa ttattactca 420 agcccctgga ggggattgag cgtccggcgc tggtgacggt attaccacat cagcaaaagg 480 gcaaaacggt ggtccttgac ttaggggcca acgtcgattg tgacagcaca atgctggtgc 540 aatttgccat tatgggctca gttctggctg aagaggtggt ggaaattccc aatcctcgcg 600 tggcgttgct caatattggt gaagaagaag taaagggtct cgacagtatt cgggatgcct 660 cagcggtgct taaaacaatc ccttctatca attatatcgg ctatcttgaa gccaatgagt 720 tgttaactgg caagacagat gtgctggttt gtgacggctt tacaggaaat gtcacattaa 780 agacgatgga aggtgttgtc aggatgttcc tttctctgct gaaatctcag ggtgaaggga 840 aaaaacggtc gtggtggcta ctgttattaa agcgttggct acaaaagagc ctgacgaggc 900 gattcagtca cctcaacccc gaccagtata acggcgcctg tctgttagga ttgcgcggca 960 cggtgataaa aagtcatggt gcagccaatc agcgagcttt tgcggtcgcg attgaacagg 1020 cagtgcaggc ggtgcagcga caagttcctc agcgaattgc cgctcgcctg gaatctgtat 1080 acccagctgg ttttgagctg ctggacggtg gcaaaagcgg aactctgcgg tagcaggacg 1140 ctgccagcga actcgcagtt tgcaagtgac ggtatataac cgaaaagtga ctgagcgtac 1200 atgtatacga agattattgg tactggcagc tatctgcccg aacaagtgcg gacaaacgcc 1260 gatttggaaa aaatggtgga cacctctgac gagtggattg tcactcgtac cggtatccgc 1320 gaacgccaca ttgccgcgcc aaacgaaacc gtttcaacca tgggctttga agcggcgaca 1380 cgcgcaattg agatggcggg cattgagaaa gaccagattg gcctgatc 1428 // |
|