EBI Dbfetch

ID   M88143; SV 1; linear; genomic DNA; STD; PRO; 1268 BP.
XX
AC   M88143;
XX
DT   16-MAR-1992 (Rel. 31, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Klebsiella oxytoca tnpR gene, 3' end and TEM-12 beta-lactamase (blaT-12)
DE   gene, complete cds.
XX
KW   extended-spectrum beta-lactamase; TEM-26B beta-lactamase.
XX
OS   Klebsiella oxytoca
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Klebsiella.
XX
RN   [1]
RP   1-1268
RX   PUBMED; 1329636.
RA   Heritage J., Hawkey P.M., Todd N., Lewis I.J.;
RT   "Transposition of the gene encoding a TEM-12 extended-spectrum
RT   beta-lactamase";
RL   Antimicrob. Agents Chemother. 36(9):1981-1986(1992).
XX
CC   The ultimate source of this sequence was strain 0400-1, an isolate
CC   of Klebsiella oxytoca which is resistant to the antibiotic
CC   ceftazidime. The resistance gene is located on a transposon Tn841,
CC   which is found on a self-transmissible plasmid. I introduced this
CC   plasmid into a derivative of E.coli strain UB5201 which was
CC   carrying the multicopy plasmid pACYC184. I then obtained a
CC   recombinant plasmid in which the ceftazidime resistance determinant
CC   located on Tn841 had inserted itself, and the rest of Tn841 into
CC   plasmid pACYC184, giving the recombinant plasmid pACYC184::Tn841,
CC   and it was from this recombinant plasmid that I derived my
CC   sequence.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1268
FT                   /organism="Klebsiella oxytoca"
FT                   /strain="0400-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:571"
FT   CDS             <1..185
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /db_xref="GOA:Q48405"
FT                   /db_xref="HSSP:1GDT"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:Q48405"
FT                   /protein_id="AAA25052.1"
FT                   /translation="TNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTGATEIAHQLSI
FT                   ARSTVYKILEDERAS"
FT   variation       321
FT                   /note="'t' in Tn841 vs. 'g' in Tn3 at nucleotide 3903;
FT                   silent mutation varying from Tn3 sequence"
FT   CDS             368..1228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaT-12"
FT                   /product="TEM-26B beta-lactamase"
FT                   /note="At nucleotide 851 the codon reads SER (amino acid
FT                   162) in Tn841 and that at nucleotide 4443 in Tn3 the codon
FT                   reads ARG (amino acid 162), and it is this change which is
FT                   probably responsible for the inc"
FT                   /db_xref="GOA:Q48406"
FT                   /db_xref="HSSP:1HTZ"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48406"
FT                   /protein_id="AAA25053.1"
FT                   /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
FT                   ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
FT                   PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSW
FT                   EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
FT                   LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
FT                   LIKHW"
FT   variation       505
FT                   /gene="blaT-12"
FT                   /note="'g' in Tn841 vs. 'a' in Tn3 at nucleotide 4087;
FT                   silent mutation varying from Tn3 sequence"
FT   variation       595
FT                   /gene="blaT-12"
FT                   /note="'t' in Tn841 vs. 'c' in Tn3 at nucleotide 4177;
FT                   silent mutation varying from Tn3 sequence"
FT   variation       841
FT                   /gene="blaT-12"
FT                   /note="'c' in Tn841 vs. 't' in Tn3 at nucleotide 4423;
FT                   silent mutation varying from Tn3 sequence"
FT   variation       851
FT                   /gene="blaT-12"
FT                   /note="'a' in Tn841 vs. 'c' in Tn3 at nucleotide 4433;
FT                   mutation increasing spectrum of activity"
FT   variation       1084
FT                   /gene="blaT-12"
FT                   /note="'a' in Tn841 vs. 'g' in Tn3 at nucleotide 4666;
FT                   silent mutation varying from Tn3 sequence"
FT   misc_feature    1247..1268
FT                   /note="divergence from Tn3 sequence"
XX
SQ   Sequence 1268 BP; 345 A; 282 C; 319 G; 322 T; 0 other;
     gcacgaatga gggccgacag gaagcaaagc tgaaaggaat caaatttggc cgcaggcgta        60
     ccgtggacag gaacgtcgtg ctgacgcttc atcagaaggg cactggtgca acggaaattg       120
     ctcatcagct cagtattgcc cgctccacgg tttataaaat tcttgaagac gaaagggcct       180
     cgtgatacgc ctatttttat aggttaatgt catgataata atggtttctt agacgtcagg       240
     tggcactttt cggggaaatg tgcgcggaac ccctatttgt ttatttttct aaatacattc       300
     aaatatgtat ccgctcatga tacaataacc ctgataaatg cttcaataat attgaaaaag       360
     gaagagtatg agtattcaac atttccgtgt cgcccttatt cccttttttg cggcattttg       420
     ccttcctgtt tttgctcacc cagaaacgct ggtgaaagta aaagatgctg aagatcagtt       480
     gggtgcacga gtgggttaca tcgagctgga tctcaacagc ggtaagatcc ttgagagttt       540
     tcgccccgaa gaacgttttc caatgatgag cacttttaaa gttctgctat gtggtgcggt       600
     attatcccgt gttgacgccg ggcaagagca actcggtcgc cgcatacact attctcagaa       660
     tgacttggtt gagtactcac cagtcacaga aaagcatctt acggatggca tgacagtaag       720
     agaattatgc agtgctgcca taaccatgag tgataacact gcggccaact tacttctgac       780
     aacgatcgga ggaccgaagg agctaaccgc ttttttgcac aacatggggg atcatgtaac       840
     ccgccttgat agttgggaac cggagctgaa tgaagccata ccaaacgacg agcgtgacac       900
     cacgatgcct gcagcaatgg caacaacgtt gcgcaaacta ttaactggcg aactacttac       960
     tctagcttcc cggcaacaat taatagactg gatggaggcg gataaagttg caggaccact      1020
     tctgcgctcg gcccttccgg ctggctggtt tattgctgat aaatctggag ccggtgagcg      1080
     tggatctcgc ggtatcattg cagcactggg gccagatggt aagccctccc gtatcgtagt      1140
     tatctacacg acggggagtc aggcaactat ggatgaacga aatagacaga tcgctgagat      1200
     aggtgcctca ctgattaagc attggtaact gtcagaccaa gtttacggac tgttgcaaag      1260
     ttagcgat                                                               1268
//