![]() |
EBI DbfetchID M74134; SV 1; linear; genomic DNA; STD; PRO; 906 BP. XX AC M74134; XX DT 02-FEB-1993 (Rel. 34, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Pantoea agglomerans functionally truncted p-protein (pheA) gene, complete DE cds. XX KW . XX OS Pantoea agglomerans OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Pantoea. XX RN [1] RP 1-906 RX PUBMED; 1444388. RA Xia T., Zhao G., Jensen R.A.; RT "Loss of allosteric control but retention of the bifunctional catalytic RT competence of a fusion protein formed by excision of 260 base pairs from RT the 3' terminus of pheA from Erwinia herbicola"; RL Appl. Environ. Microbiol. 58(9):2792-2798(1992). XX FH Key Location/Qualifiers FH FT source 1..906 FT /organism="Pantoea agglomerans" FT /strain="33243" FT /mol_type="genomic DNA" FT /tissue_lib="ATCC 33243; HindIII-PstI:pUC18" FT /db_xref="taxon:549" FT CDS 1..906 FT /codon_start=1 FT /transl_table=11 FT /gene="pheA" FT /product="functionally truncted p-protein" FT /note="bifunctional enzyme: chorismate mutase (CM-P) and FT prephenate dehydratase (PDT) activities intact" FT /db_xref="GOA:Q02286" FT /db_xref="InterPro:IPR001086" FT /db_xref="InterPro:IPR002701" FT /db_xref="InterPro:IPR008242" FT /db_xref="InterPro:IPR010952" FT /db_xref="InterPro:IPR018528" FT /db_xref="InterPro:IPR020822" FT /db_xref="UniProtKB/Swiss-Prot:Q02286" FT /protein_id="AAA24853.1" FT /translation="MNPDNPLLALRDKISAVDKKLLTLLAERRLLAVEVAQAKLATHRP FT IRDVERERALLENLIVLGKAHNLDAHYITRLFQLVIEDSVLTQQALLQKNLNHPHAHAA FT RIAFLGPKGSYSHLAARNYASRHFDSMVECGCLKFHDIIKQVENGVADYAVMPIENTSS FT GSINDVYDLLQQTSLSIVGELTLPIDHCVLVNGPTDLQQIETVYSHPQPFQQCSQFINR FT FPHWKIEYTESTAAAMEKVAALNSPKVAALGSEAGGELYQLQVLERNLANQQQNHTRFI FT VLARKAIEVSDQVPAKTTLK" FT misc_feature 902..>906 FT /gene="pheA" FT /standard_name="pUC18" FT /note="near SspI site" XX SQ Sequence 906 BP; 222 A; 256 C; 242 G; 186 T; 0 other; atgaatcccg ataatccatt gctggcgcta cgcgacaaaa tcagcgccgt ggataaaaaa 60 cttctgacgc tgctggccga gcgtcgtttg ctggcagtgg aagttgcaca agcgaaactg 120 gcgacgcatc gcccgattcg ggatgtggag cgcgaacgcg cgctactgga gaatctcatc 180 gtactgggta aggcacacaa cctggatgcg cactacatca cccgtctgtt ccagctggta 240 attgaagatt ccgtgctgac tcagcaagcg ctgctgcaaa aaaacctcaa ccatccccat 300 gcgcatgccg cccgtatcgc ctttctgggc ccgaaaggct cttattcgca tcttgcagca 360 cgcaactacg cgtcgcgcca tttcgatagc atggtggagt gtggctgcct gaagtttcac 420 gacatcatca aacaggtcga aaatggcgta gctgattacg ccgtgatgcc gattgagaat 480 accagttcag gctcgatcaa cgatgtctac gatctgctgc aacagaccag cctctcaatc 540 gtgggcgagc tgacattgcc tatcgaccac tgcgtgctgg tgaatggccc caccgatctt 600 cagcagattg agacggttta cagccatcct caaccgttcc agcagtgcag ccagtttatt 660 aatcgtttcc cgcactggaa aatcgaatac accgagagta ccgcggcagc gatggagaaa 720 gtggctgcgc tcaactcacc taaggtggcg gcgctgggca gtgaggccgg cggcgaactg 780 tatcagctgc aggtgctgga acgtaatctg gcgaatcagc agcagaacca cacccgcttt 840 atcgtgctgg cccgcaaagc aatcgaggtt tctgaccagg tgccagcgaa aaccacgctg 900 aaataa 906 // ![]() |