![]() |
EBI DbfetchID M73500; SV 1; linear; genomic DNA; STD; PRO; 270 BP. XX AC M73500; XX DT 20-JUL-1991 (Rel. 28, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 8) XX DE B.stearothermophilus hubst gene, complete cds. XX KW DNA-binding protein. XX OS Geobacillus stearothermophilus OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Geobacillus. XX RN [1] RP 1-270 RX DOI; 10.1016/0378-1119(92)90487-A RX PUBMED; 1644313. RA Padas P.M., Wilson K.S., Vorgias C.E.; RT "The DNA-binding protein HU from mesophilic and thermophilic bacilli: gene RT cloning, overproduction and purification"; RL Gene 117(1):39-44(1992). XX FH Key Location/Qualifiers FH FT source 1..270 FT /organism="Geobacillus stearothermophilus" FT /mol_type="genomic DNA" FT /db_xref="taxon:1422" FT CDS 1..>270 FT /codon_start=1 FT /transl_table=11 FT /gene="hubst" FT /product="hubst" FT /db_xref="GOA:P0A3H0" FT /db_xref="InterPro:IPR000119" FT /db_xref="InterPro:IPR010992" FT /db_xref="InterPro:IPR020816" FT /db_xref="PDB:1HUE" FT /db_xref="PDB:1HUU" FT /db_xref="UniProtKB/Swiss-Prot:P0A3H0" FT /protein_id="AAA22532.1" FT /translation="MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLI FT GFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK" XX SQ Sequence 270 BP; 88 A; 58 C; 77 G; 47 T; 0 other; atgaacaaga cggagttgat caacgcggta gctgagacaa gcggtctttc caaaaaagat 60 gcaacaaaag ccgttgatgc ggtatttgac tcgattacag aagcgttgcg aaaaggcgat 120 aaagtgcaat taatcggctt tgggaacttt gaagtgcgcg agcgcgctgc ccggaaagga 180 cgcaacccgc aaacgggcga agaaatggaa attccggcga gcaaagttcc tgcattcaaa 240 ccgggtaaag ccctgaaaga cgccgtgaaa 270 // ![]() |