![]() |
EBI DbfetchID M63491; SV 1; linear; genomic DNA; STD; PRO; 1403 BP. XX AC M63491; XX DT 20-MAY-1992 (Rel. 31, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 4) XX DE Escherichia coli 1-acyl-sn-glycerol-3-phosphate acyltransferase (plsC) DE gene, complete cds; periplasmic protein (sufI) gene, 3' end; and peripheral DE membrane protein (parC) gene, 5' end. XX KW 1-acyl-sn-glycerol-3-phosphate acyltransferase; KW cytoplasmic membrane protein; peripheral membrane protein; KW periplasmic protein. XX OS Escherichia coli OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; OC Enterobacteriaceae; Escherichia. XX RN [1] RP 1-1403 RX PUBMED; 1557036. RA Coleman J.; RT "Characterization of the Escherichia coli gene for RT 1-acyl-sn-glycerol-3-phosphate acyltransferase (plsC)"; RL Mol. Gen. Genet. 232(2):295-303(1992). XX FH Key Location/Qualifiers FH FT source 1..1403 FT /organism="Escherichia coli" FT /strain="K-12" FT /mol_type="genomic DNA" FT /cell_line="CS520" FT /tissue_lib="Clarke-Carbon" FT /db_xref="taxon:562" FT CDS <1..91 FT /codon_start=2 FT /transl_table=11 FT /gene="parC" FT /product="peripheral membrane protein" FT /function="chromosome partitioning" FT /db_xref="GOA:P0AFI2" FT /db_xref="InterPro:IPR005742" FT /db_xref="PDB:1ZVT" FT /db_xref="UniProtKB/Swiss-Prot:P0AFI2" FT /protein_id="AAA24396.1" FT /translation="RGTLMRGLQRIDRVEIDSPRRASSGDSEE" FT promoter 222..250 FT /gene="plsC" FT CDS 325..1062 FT /codon_start=1 FT /transl_table=11 FT /gene="plsC" FT /product="1-acyl-glycerol-3-phosphate acyltransferase" FT /function="produces diacyl-glycerol-3-phosphate" FT /db_xref="GOA:P26647" FT /db_xref="InterPro:IPR004552" FT /db_xref="UniProtKB/Swiss-Prot:P26647" FT /protein_id="AAA24397.1" FT /translation="MLYIFRLIITVIYSILVCVFGSIYCLFSPRNPKHVATFGHMFGRL FT APLFGLKVECRKPTDAESYGNAIYIANHQNNYDMVTASNIVQPPTVTVGKKSLLWIPFF FT GQLYWLTGNLLIDRNNRTKAHGTIAEVVNHFKKRRISIWMFPEGTRSRGRGLLPFKTGA FT FHAAIAAGVPIIPVCVSTTSNKINLNRLHNGLVIVEMLPPIDVSQYGKDQVRELAAHCR FT SIMEQKIAELDKEVAEREAAGKV" FT CDS 1137..>1403 FT /codon_start=1 FT /transl_table=11 FT /gene="16aoh-c" FT /product="periplasmic protein" FT /function="supresses ftsI mutation" FT /db_xref="GOA:P26648" FT /db_xref="InterPro:IPR017909" FT /db_xref="PDB:2UXT" FT /db_xref="UniProtKB/Swiss-Prot:P26648" FT /protein_id="AAA24398.1" FT /translation="MSLSRRQFIQASGIALCAGAVPLKASAAGQQQPLPVPPLLESRRG FT QPLFMTVQRAHWSFTPGTRASVWGINGRYLGPTIRVWKGDDVKL" XX SQ Sequence 1403 BP; 328 A; 363 C; 360 G; 352 T; 0 other; ccgcggtacg ttgatgcgcg gtttgcagcg tatcgatcgt gttgagatcg actctcctcg 60 ccgtgccagc agcggtgata gcgaagagta atatgccggg gagggcgctg tttcctcccg 120 cttgcaagga acgccggatg aaacgttaag tcgtcatccg gcagcgtatt caacccccgg 180 aaacgataaa aattcccttg aaaccgttgt ttattcatgc gttgcgatta acaatacgct 240 tttccagaga gcggctttta acaatgccct aacctgattt caggtgacgt acaatgccag 300 tctctcagac cttcagaggg tgttatgcta tatatctttc gtcttattat taccgtgatt 360 tacagcatct tagtctgtgt attcggctcc atttactgcc ttttcagccc gcgtaacccg 420 aaacatgtgg ccacctttgg gcatatgttt ggccgtcttg cgccgctgtt tggcctgaaa 480 gttgagtgcc gtaaacctac agacgctgaa agctacggca atgctatcta tatcgctaac 540 caccagaaca actatgacat ggtgacagca tcgaacatcg tgcaaccgcc gacggtgacg 600 gtaggtaaaa agagcttgct gtggatcccc ttcttcgggc agttgtactg gttaaccggc 660 aacttattga tcgacagaaa caatcgcact aaagctcacg gcaccattgc ggaagtagtg 720 aatcacttca aaaaacgccg tatttccatc tggatgttcc cggaaggaac ccgcagccgt 780 ggtcgcggcc tgctaccgtt caagactgga gcatttcacg cggcaattgc ggcgggcgtc 840 ccgattattc ccgtgtgcgt ctctacaact tcgaataaga ttaatcttaa tcgactgcac 900 aacggtctgg tgattgtcga aatgctgccg ccaattgacg tcagtcagta tggcaaagat 960 caggttcgtg agctggctgc ccattgtcgt tcgataatgg aacaaaaaat cgccgagctc 1020 gataaagaag tcgcagaacg cgaagccgcc ggaaaagttt aagtcggcaa tctgtatttt 1080 tgcggggaac actttcctgc acggtattac tttagccagt tttacatgga gcaaatatgt 1140 cactcagtcg gcgtcagttc attcaggcat cggggattgc actttgtgca ggcgctgttc 1200 ccctgaaggc cagcgcagcc gggcaacagc aaccgctacc cgttccgccg ctacttgaat 1260 ctcgccgtgg gcaaccgctg tttatgactg tacaacgtgc gcactggtca tttacgccag 1320 ggacacgcgc gtcggtctgg ggaatcaatg gtcgttacct ggggccgact atccgcgtct 1380 ggaagggcga cgatgttaag ctt 1403 // ![]() |