![]() |
EBI DbfetchID M21406; SV 1; linear; mRNA; STD; VRT; 1648 BP. XX AC M21406; XX DT 22-APR-1989 (Rel. 19, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 5) XX DE Chicken ovary-specific mRNA similar to mammalian cytochrome P450c17, DE complete cds. XX KW cytochrome; cytochrome P450. XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-1648 RX DOI; 10.1016/0378-1119(88)90226-0 RX PUBMED; 3047010. RA Ono H., Iwasaki M., Sakamoto N., Mizuno S.; RT "cDNA cloning and sequence analysis of a chicken gene expressed during the RT gonadal development and homologous to mammalian cytochrome P-450c17"; RL Gene 66(1):77-85(1988). XX DR Ensembl-Gn; ENSGALG00000000550; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000000692; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000001081; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000001115; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004155; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000004686; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005002; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005672; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000008121; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000000766; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000000975; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001617; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001683; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000006605; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000007466; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000008011; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000009094; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000013182; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000033172; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040459; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040463; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000040470; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..1648 FT /organism="Gallus gallus" FT /mol_type="mRNA" FT /db_xref="taxon:9031" FT mRNA <1..1648 FT /note="cytochrome P450 mRNA" FT CDS 17..1543 FT /codon_start=1 FT /note="cytochrome P450" FT /db_xref="GOA:P12394" FT /db_xref="InterPro:IPR001128" FT /db_xref="InterPro:IPR002401" FT /db_xref="InterPro:IPR017972" FT /db_xref="InterPro:IPR017973" FT /db_xref="UniProtKB/Swiss-Prot:P12394" FT /protein_id="AAA48997.1" FT /translation="MPPLAVLLLALALLCAWRLSYSQGPTGTGTGRPRSLPALPLVGSL FT LQLAGHPQLHLRLWRLQGRYGSLYGLWMGSHYVVVVNSYQHAREVLLKKGKAFAGRPRT FT VTTDLLSRGGKDIAFASYGPLWKFQRKLVHAALSMFGEGSVALEKIICREAASLCETLG FT AAQDMALDMAPELTRAVTNVVCSLCFNSSYRRGDPEFEAMLEYSQGIVDTVAKESLVDI FT FPWLQIFPNRDLALLKRCLKVRDQLLQQKFTEHKEAFCGDTVRDLMDALLQVRLNAENN FT SPLEPGLELTDDHLLMTVGDIFGAGVETTTTVLKWAVLYLLHYPEVQKKIQEEMDQKIG FT LARHPHLSDRPLLPYLEATISEGLRIRPVSPLLIPHVSLADTSIGEYSIPKGARVVINL FT WSVHHDEKEWDKPEEFNPGRFLDEQGQHIHSPSPSYLPFGAGIRVCLGEVLAKMELFLF FT LAWVLQRFTLECPQDQPLPSLEGKFGVVLQVQKFRVKARLREAWRGEMVR" XX SQ Sequence 1648 BP; 293 A; 511 C; 532 G; 312 T; 0 other; ggggagcaat cccaccatgc cgccgctcgc tgtcctgctg cttgccctgg ccctgctctg 60 tgcctggagg ctgtcgtaca gtcagggtcc cacggggacg gggacggggc ggccgcggag 120 ccttccagcc ctgccgctgg tggggagcct gctgcagctg gccgggcacc cgcagctcca 180 cctgcggctc tggcgcctgc agggccgcta cggcagcctc tacgggctct ggatgggctc 240 ccactacgtg gtggtggtca acagctacca gcacgcccgg gaggtgctgc tgaagaaggg 300 gaaggctttc gccggacggc ctcgcaccgt gaccacggac ctactgtccc gcgggggaaa 360 ggacatcgcc tttgccagct acggtcccct ctggaagttc cagcgcaaac tggtgcatgc 420 tgccctctcc atgtttgggg agggctcagt cgccctggag aagatcatct gccgggaggc 480 cgcatccctg tgtgagacgc tgggtgctgc gcaggatatg gccctagaca tggccccgga 540 gctcacacgg gccgtcacca atgtggtctg ctccctctgc ttcaactcct cctaccgacg 600 cggggacccc gagttcgagg ccatgctgga gtacagccag ggcatcgtgg acaccgtggc 660 caaggagagc ctggtggaca tcttcccctg gctacagatc ttccccaaca gggacttggc 720 tctgctgaag cgatgcctga aggtcaggga ccagctgctc cagcagaagt tcactgaaca 780 caaggaagca ttctgtgggg acactgtgag ggacctgatg gatgccctcc tgcaagtgag 840 gctcaatgct gagaacaaca gccctcttga gccaggtctg gagctgacag atgaccacct 900 cctcatgacg gtgggggaca tctttggggc tggcgtggag accaccacca ctgtgctcaa 960 gtgggctgtg ctctacctgc tccactaccc cgaggtccag aagaagatcc aggaggagat 1020 ggaccagaag attggcctgg cacgtcaccc ccacctcagt gaccgcccac tgctgcccta 1080 cctggaggct accatcagcg aggggctgcg catccggccc gtgtcccccc tgctcatccc 1140 acatgtgtcc cttgctgaca ccagcatcgg tgagtactcc atccccaagg gcgccagggt 1200 ggtcatcaac ctctggtccg tgcaccacga tgagaaggag tgggataaac ctgaggagtt 1260 caaccctggc cgcttcctgg atgagcaggg ccagcacatc cactcaccct ctcccagcta 1320 cctgcccttt ggggccggca tccgcgtgtg cctgggtgaa gtcctggcca agatggagct 1380 cttcctcttc ctggcctggg tgctgcagag attcacgctc gagtgtccgc aggatcagcc 1440 cctgccctcg ctggagggca agtttggcgt tgtgctgcag gtgcagaagt ttcgggtgaa 1500 ggccaggctg agggaggcct ggaggggcga gatggtgagg tgagatgggg ttgttggata 1560 ggtggaatgg ggtgggtgga cgccgtagag actgcgctct gcctgcctca tggatgtgag 1620 attgtctgaa taaagctgtc cccaaccc 1648 // ![]() |