![]() |
EBI DbfetchID M18427; SV 1; linear; genomic DNA; STD; INV; 224 BP. XX AC M18427; XX DT 16-JUL-1988 (Rel. 16, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 3) XX DE C.erythrocephala abl proto-oncogene (homologous within the tyrosine DE protein-kinase-coding domain), partial cds. XX KW abl proto-oncogene. XX OS Calliphora vicina OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; OC Endopterygota; Diptera; Brachycera; Muscomorpha; Oestroidea; Calliphoridae; OC Calliphorinae; Calliphora. XX RN [1] RP 1-224 RX DOI; 10.1016/0378-1119(87)90267-8 RX PUBMED; 3125084. RA Durica D.S., Restrepo M.A., Thomas T.L., Beckingham K.; RT "Isolation and characterization of abl gene sequences in Calliphora RT erythrocephala"; RL Gene 59(1):63-76(1987). XX CC Draft entry and computer-readable sequence for [1] kindly provided CC by D.S.Durica, 16-SEP-1988. XX FH Key Location/Qualifiers FH FT source 1..224 FT /organism="Calliphora vicina" FT /mol_type="genomic DNA" FT /db_xref="taxon:7373" FT CDS <1..>224 FT /codon_start=1 FT /note="abl homolog protein; putative" FT /db_xref="GOA:P11681" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR001245" FT /db_xref="InterPro:IPR008266" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR020685" FT /db_xref="InterPro:IPR020700" FT /db_xref="UniProtKB/Swiss-Prot:P11681" FT /protein_id="AAA28232.1" FT /translation="RETLDAVALLYMATQIASGMSYLEARNYIHRDLAARNCLVGDNKL FT VKVADFGLARLMRDDTYTAHAGAKFPIKWT" XX SQ Sequence 224 BP; 51 A; 49 C; 62 G; 62 T; 0 other; cgtgagaccc tcgatgccgt agccctgctg tatatggcaa cgcaaatagc gtcgggcatg 60 agttatttgg aagctcgtaa ttacatacat cgtgacttgg ctgcccgtaa ttgtttggtg 120 ggcgataata aattggttaa agtggccgat tttggtttgg ctcgtctgat gcgtgatgac 180 acctatacgg cacatgcggg cgccaagttt cccatcaaat ggac 224 // ![]() |