![]() |
EBI DbfetchID M16219; SV 1; linear; mRNA; STD; PLN; 481 BP. XX AC M16219; XX DT 02-APR-1988 (Rel. 15, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Cucumber (C.sativus) glyoxysomal malate synthase mRNA, partial cds. XX KW glyoxysomal malate synthase. XX OS Cucumis sativus (cucumber) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids I; Cucurbitales; Cucurbitaceae; Cucumis. XX RN [1] RP 1-481 RX PUBMED; 16664899. RA Smith S.M., Leaver C.J.; RT "Glyoxysomal Malate Synthase of Cucumber: Molecular Cloning of a cDNA and RT Regulation of Enzyme Synthesis during Germination"; RL Plant Physiol. 81(3):762-767(1986). XX CC Because of the sequencing methods the authors [1] are unsure of the CC first base. XX FH Key Location/Qualifiers FH FT source 1..481 FT /organism="Cucumis sativus" FT /mol_type="mRNA" FT /db_xref="taxon:3659" FT mRNA <1..481 FT /note="MS mRNA" FT CDS <1..286 FT /codon_start=2 FT /note="glyoxysomal malate synthase (EC 4.1.3.1)" FT /db_xref="GOA:P08216" FT /db_xref="InterPro:IPR019830" FT /db_xref="UniProtKB/Swiss-Prot:P08216" FT /protein_id="AAA33123.1" FT /translation="GSRVQNWQWLKYGVELDGDGLGVRVNKELFGRVVEEEMERIEREV FT GKERFKKGMYKEACKMFTRQCTAPNLDDFLTLDAYNYIVIHHPRELSKL" XX SQ Sequence 481 BP; 152 A; 74 C; 114 G; 140 T; 1 other; nggtagcagg gttcaaaact ggcaatggct gaagtatgga gtggaattgg atggagatgg 60 gcttggtgtg agagtgaaca aggaactgtt tgggagagtg gtggaagaag aaatggaaag 120 gattgaaaga gaagttggga aagagagatt caaaaaagga atgtacaaag aagcttgcaa 180 gatgttcaca aggcaatgca cagctccaaa tttggatgac tttctgacct tagacgctta 240 caactatatt gttatacatc atccaaggga attgtccaag ctttgaaaag tgaaaaccac 300 caccaaaaca cttgcttttg cttccattct cttcttgtta ctgagaataa cgtatctgta 360 atgtaagtct gtctttgtcc atttcttttt gcaagctgtg tggttatttc aagaaatcca 420 gcaattgcaa gcaaattgga attcggtact tctctatata taaacctata ttttgcctgt 480 t 481 // ![]() |