![]() |
EBI DbfetchID M15674; SV 1; linear; genomic DNA; STD; PRO; 1310 BP. XX AC M15674; XX DT 02-APR-1988 (Rel. 15, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Bacillus amyloliquefaciens beta-glucanase (bglA) gene, complete cds. XX KW beta-glucanase; glucanase. XX OS Bacillus amyloliquefaciens OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Bacillus. XX RN [1] RP 1-1310 RX DOI; 10.1016/0378-1119(86)90278-7 RX PUBMED; 3106158. RA Hofemeister J., Kurtz A., Borriss R., Knowles J.; RT "The beta-glucanase gene from Bacillus amyloliquefaciens shows extensive RT homology with that of Bacillus subtilis"; RL Gene 49(2):177-187(1986). XX CC Draft entry and clean copy of sequence in [1] kindly provided by CC J.Hofemeister, 16-JUN-1987. CC There are two putative promoters. The first is located at CC positions 393 to 398 (-35 region) and 417 to 422 (-10 region). The CC second is located at positions 410 to 415 (-35 region) and 435 to CC 440 (-10 region). There is a putative ribosome binding site at CC positions 451 to 458. XX FH Key Location/Qualifiers FH FT source 1..1310 FT /organism="Bacillus amyloliquefaciens" FT /mol_type="genomic DNA" FT /clone="pEG1" FT /tissue_lib="ATCC 15841/BE20/78" FT /db_xref="taxon:1390" FT CDS <1..258 FT /codon_start=1 FT /transl_table=11 FT /note="open reading frame; putative" FT /db_xref="GOA:Q44651" FT /db_xref="HSSP:1H99" FT /db_xref="InterPro:IPR011608" FT /db_xref="UniProtKB/TrEMBL:Q44651" FT /protein_id="AAA87322.1" FT /translation="EFNEESLHYYRFVTHLKFFDQRLFNGTHMESQDDFLLETVKEKYH FT QAYKCTKNIHTYIEKEYGHKLTSDELLYLTIHIERVVKQV" FT sig_peptide 469..543 FT /product="beta-glucanase" FT CDS 469..1188 FT /codon_start=1 FT /transl_table=11 FT /product="beta-glucanase" FT /EC_number="3.2.1.73" FT /db_xref="GOA:P07980" FT /db_xref="HSSP:1GBG" FT /db_xref="InterPro:IPR008263" FT /db_xref="UniProtKB/Swiss-Prot:P07980" FT /protein_id="AAA87323.1" FT /translation="MKRVLLILVTGLFMSLCGITSSVSAQTGGSFFEPFNSYNSGLWQK FT ADGYSNGDMFNCTWRANNVSMTSLGEMRLALTSPSYNKFDCGENRSVQTYGYGLYEVRM FT KPAKNTGIVSSFFTYTGPTEGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKFADLGF FT DAANAYHTYAFDWQPNSIKWYVDGQLKHTATTQIPAAPGKIMMNLWNGTGVDDWLGSYN FT GVNPIYAHYDWMRYRKK" FT mat_peptide 544..1185 FT /product="beta-glucanase" FT /EC_number="3.2.1.73" XX SQ Sequence 1310 BP; 402 A; 242 C; 294 G; 372 T; 0 other; gaattcaacg aagaatcgct gcactattat cgattcgtca cccacttaaa gtttttcgac 60 cagcgtcttt ttaacggcac acacatggaa agccaggacg attttttact ggagacagtg 120 aaagaaaagt atcatcaggc gtataaatgc acgaagaata tccataccta cattgagaaa 180 gagtatgggc ataagctcac cagtgacgag ctgctgtatt taacgattca catagaaagg 240 gtagtcaaac aagtataatg aaagcgcttt cctcgtatta attgtttctt ccattcatat 300 ataggattgt tacggataaa gcaggcaaaa cctatctgtc tgtgctgatg gtagtttagg 360 tttgtatttt taacagaagg attatcatta tttcgaccga tgttcccttt gaaaaggatc 420 atgtatgatc aataaagaaa gcgtgttcaa aaaaggggga atgctaacat gaaacgagtg 480 ttgctaattc ttgtcaccgg attgtttatg agtttgtgtg ggatcacttc tagtgtttcg 540 gctcaaacag gcggatcgtt ttttgaacct tttaacagct ataactccgg gttatggcaa 600 aaagctgatg gttactcaaa tggagatatg tttaactgca cttggcgtgc taataacgtc 660 tctatgacgt cattaggtga aatgcgtttg gcgctgacaa gtccgtctta taacaagttt 720 gactgcgggg aaaaccgctc ggttcaaaca tatggctatg gactttatga agtcagaatg 780 aaaccggcta aaaacacagg gattgtttca tcgttcttca cttatacagg tccaacggag 840 gggactcctt gggatgagat tgatatcgaa tttttgggaa aagacacaac gaaggttcaa 900 tttaactatt atacaaatgg cgcaggaaac catgagaagt tcgcggatct cggatttgat 960 gcagccaatg cctatcatac gtatgcgttc gattggcagc caaactctat taaatggtat 1020 gtcgatgggc aattaaaaca tactgcaaca acccaaatac cggcagcgcc ggggaaaatc 1080 atgatgaatt tgtggaatgg tacgggtgtt gatgattggc tcggttccta caatggcgta 1140 aatccgatat acgctcatta cgactggatg cgctatagaa aaaaataatg tacagaaaag 1200 gatttcgctg gcggaatcct tttttgatta aaacgaaata atcccaatca aaagcgccgc 1260 aatcgtcatt acaatcgttg tccccacggc ccatttgatg gtgaattttt 1310 // ![]() |