![]() |
EBI DbfetchID M13787; SV 1; linear; mRNA; STD; MUS; 601 BP. XX AC M13787; XX DT 09-MAR-1987 (Rel. 11, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 7) XX DE Mouse Ig unrearranged transcribed H-chain V-region VH558 mRNA, clone A1/A4. XX KW C-region; germline; immunoglobulin heavy chain; V-region. XX OS Mus musculus (house mouse) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; OC Muridae; Murinae; Mus. XX RN [1] RP 1-601 RX DOI; 10.1016/0092-8674(85)90141-2 RX PUBMED; 2578321. RA Yancopoulos G.D., Alt F.W.; RT "Developmentally controlled and tissue-specific expression of unrearranged RT VH gene segments"; RL Cell 40(2):271-281(1985). XX DR IMGT/LIGM; M13787. XX CC The sequence below is annotated as a germline variable gene CC segment. CC This germline transcript has all of the characteristics of a mature CC mRNA: normally spliced, polyadenylated, and transported to the CC cytoplasm. Preliminary experimental data indicate this VH CC transcript can be translated into protein [1]. A potential stop CC codon can be found at positions 398 to 400. XX FH Key Location/Qualifiers FH FT source 1..601 FT /organism="Mus musculus" FT /sub_species="domesticus" FT /strain="BALB/c" FT /mol_type="mRNA" FT /cell_line="V to DJ rearranging pre-B cell" FT /db_xref="taxon:10090" FT mRNA <1..601 FT /note="VH558 mRNA" FT sig_peptide 26..82 FT CDS 26..>376 FT /codon_start=1 FT /product="immunoglobulin heavy chain" FT /note="precursor" FT /db_xref="GOA:P06327" FT /db_xref="InterPro:IPR003596" FT /db_xref="InterPro:IPR007110" FT /db_xref="InterPro:IPR013106" FT /db_xref="InterPro:IPR013783" FT /db_xref="UniProtKB/Swiss-Prot:P06327" FT /protein_id="AAA38499.1" FT /translation="MGWRWIFLFLLSGTAGVHCQVQLQQSGPELVKPGALVKISCKASG FT YTFTSYDINWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADKSSSTAYMQLSS FT LTSENSAVYFCAR" FT mat_peptide 83..>376 FT /product="immunoglobulin heavy chain" FT /note="VH558 region" FT misc_signal 377..415 FT /note="recombination recognition sequence; putative" FT iDNA 377..>601 FT /note="V-D intervening DNA (5' end +/- 1 bp)" XX SQ Sequence 601 BP; 161 A; 128 C; 145 G; 167 T; 0 other; tgtggagagg acactgactc taaccatggg atggagatgg atctttcttt tcctcctgtc 60 aggaactgca ggtgtccatt gccaggttca gctgcagcag tctggacctg agctggtgaa 120 gcctggggct ttagtgaaga tatcctgcaa ggcttctggt tacaccttca caagctacga 180 tataaactgg gtgaagcaga ggcctggaca gggacttgag tggattggat ggatttatcc 240 tggagatggt agtactaagt acaatgagaa attcaagggc aaggccacac tgactgcaga 300 caaatcctcc agcacagcct acatgcagct cagcagcctg acttctgaga actctgcagt 360 ctatttctgt gcaagacaca gtgttgtaac cacatcctga gtgtgtcaga aaccctggag 420 gagcaggaag ctgcactggg attgagatga cagaaatatt aatccttaga cttgctctga 480 atttgtaatt ttgaatgtcc atttattacc tcctcctcag agtcctatag tgcctttttc 540 agctttgtat atgtccatct gagtaaaatg atgatttttg aataaaccta aaattcttca 600 c 601 // ![]() |