![]() |
EBI DbfetchID L78064; SV 1; linear; genomic DNA; STD; PRO; 1470 BP. XX AC L78064; XX DT 16-MAY-1996 (Rel. 47, Created) DT 06-JUL-1999 (Rel. 60, Last updated, Version 4) XX DE Methylobacillus flagellatum pqqD and pqqG genes, complete cds, pqqC gene, DE 5' end. XX KW . XX OS Methylobacillus flagellatus OC Bacteria; Proteobacteria; Betaproteobacteria; Methylophilales; OC Methylophilaceae; Methylobacillus. XX RN [1] RP 1-1470 RX DOI; 10.1016/0378-1097(96)00217-0 RX PUBMED; 8768519. RA Gomelsky M., Biville F., Gasser F., Tsygankov Y.D.; RT "Identification and characterization of the pqqDGC gene cluster involved in RT pyrroloquinoline quinone production in an obligate methylotroph RT Methylobacillus flagellatum"; RL FEMS Microbiol. Lett. 141(2-3):169-176(1996). XX FH Key Location/Qualifiers FH FT source 1..1470 FT /organism="Methylobacillus flagellatus" FT /mol_type="genomic DNA" FT /db_xref="taxon:405" FT RBS 219..227 FT gene 229..1302 FT /gene="pqqD" FT CDS 229..303 FT /codon_start=1 FT /transl_table=11 FT /gene="pqqD" FT /note="homologous to Acinetobacter calcoaceticus pqqIV, FT Klebsiella pneumoniae pqqA, Pseudomonas fluorescens pqqA FT and Methylobacterium extorquens AM1 pqqD" FT /db_xref="GOA:Q50436" FT /db_xref="InterPro:IPR011725" FT /db_xref="UniProtKB/Swiss-Prot:Q50436" FT /protein_id="AAB42379.1" FT /translation="MMWTKPEVTEMRFGFEVTMYVCNR" FT terminator 325..346 FT /gene="pqqD" FT /note="putatve" FT RBS 376..379 FT /gene="pqqD" FT CDS 385..1302 FT /codon_start=1 FT /transl_table=11 FT /gene="pqqD" FT /function="involved in transport of PQQ or its precursor to FT the periplasm" FT /note="homologous to A. calcoaceticus pqqV, K. pneumoniae FT pqqB, P. fluorescens pqqB and M. extorquens pqqG; putative" FT /db_xref="GOA:Q50437" FT /db_xref="InterPro:IPR011842" FT /db_xref="UniProtKB/Swiss-Prot:Q50437" FT /protein_id="AAB42380.1" FT /translation="MHIHVLGSAAGGGFPQWNCNCPNCDGLRKGTIKAKKRTQSSICVS FT ADGINWVLFNTSPDILQQIQEFAPLQPGRAIRDTGVVGIVLIDAQIDHTTGLLMLREGQ FT VKREIYCTDMVYQDLTTGNPLLNILDHYCGVNRHDIPIDGKHSFSVEHAPGLRFTAVAL FT KSAAPPYSPHRHDPHPGDTIGVLIEDLNNGKKAFYAPGLGEIEPHLPALMEQADCIMVD FT GTFWTDTEMLDMGLMSKKARDIGHNPQSGPGGMMEVLDGYPGARRVLIHINNTNPILRE FT DSAERVELTRRGIEVAYDGMDIIL" FT RBS 1301..1305 FT gene 1314..1470 FT /gene="pqqC" FT CDS 1314..>1470 FT /codon_start=1 FT /transl_table=11 FT /gene="pqqC" FT /db_xref="GOA:Q50438" FT /db_xref="InterPro:IPR004305" FT /db_xref="UniProtKB/Swiss-Prot:Q50438" FT /protein_id="AAB42381.1" FT /translation="MNAPLTDNIPWTREEFEQKLRDKGRGYHIYHPFHVMMYEGKLTRE FT QLQCWVA" XX SQ Sequence 1470 BP; 351 A; 414 C; 393 G; 312 T; 0 other; acgcgtacgt aatcatcctc catgatcagg cctcgcaaga ggcctgatta cttccagcct 60 tgatcgcggc ttggttctgc tcggtcaact catgataatc atgagatgac tttcggtgtt 120 ttcgcactgt ttcacccgac ttcctcattg cacaatgcac tcacgttgct gtcaggcttg 180 tttgccgggc ggcagcgata tcaaatcaat tcaatttaaa ggagaagtat gatgtggacc 240 aagccagaag tcactgaaat gcgtttcggt tttgaagtca ctatgtacgt ttgcaatcgc 300 taagcgattg taagtgacgt gatcgccggg aaccgaggtt cccggcaatt catcagcaaa 360 aatcgaattc tacaaaaggc tgatatgcat attcatgttc tagggtcggc agcaggcggc 420 ggtttcccgc aatggaactg caactgcccg aattgtgacg gcctacgcaa aggcacgatc 480 aaggcaaaaa aacgcacgca gtcatccatc tgcgtcagtg ccgacggcat caactgggtg 540 ctgttcaaca cttcccccga cattctgcag caaattcagg aatttgcccc attgcaaccc 600 ggccgcgcga tccgcgatac gggagtcgtg ggcatcgtgc tgatcgatgc acaaatcgac 660 catacgacgg gtctcctgat gctacgcgag ggccaggtca agcgcgagat ttactgtacc 720 gacatggtgt accaggacct gaccaccggc aaccccttgc tcaacattct cgatcattat 780 tgcggcgtga accgccacga catcccaatt gacgggaaac acagtttcag cgttgagcac 840 gcgcctggct tacgctttac cgccgttgcc ctgaaaagtg ctgcgccgcc gtattccccg 900 caccgtcacg atccccatcc gggcgatacc atcggcgtgc tgatcgaaga cctcaataac 960 ggcaagaagg cattctatgc acccgggctg ggcgagatcg agccccacct gcccgctctg 1020 atggagcagg cagactgcat catggtggat ggtacgttct ggacggatac cgagatgctc 1080 gacatgggcc tcatgagcaa gaaggctcgc gacatcggcc ataacccgca gtccggcccc 1140 ggcggcatga tggaggtgct ggatggctat cccggtgcgc ggcgcgtgct gatccatatc 1200 aataacacca accccatact gcgggaagat tctgccgaac gtgttgaatt gaccaggcgc 1260 ggtatcgagg tcgcctacga cggcatggac attattctct aggagcgagc gagatgaatg 1320 caccactgac agataatatt ccctggacac gcgaagagtt cgagcagaag ctgcgcgaca 1380 agggtagggg ataccatatc taccacccgt tccacgtgat gatgtatgaa ggcaagctca 1440 cccgcgagca attgcagtgc tgggtcgcca 1470 // ![]() |