![]() |
EBI DbfetchID K02635; SV 1; linear; mRNA; STD; PLN; 512 BP. XX AC K02635; XX DT 28-JAN-1986 (Rel. 08, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 7) XX DE Barley alpha-amylase type B isozyme mRNA, clone 168. XX KW alpha-amylase; amylase. XX OS Hordeum vulgare OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; OC Pooideae; Triticeae; Hordeum. XX RN [1] RP 1-512 RX PUBMED; 6335720. RA Huang J.-K., Swegle M., Dandekar A.M., Muthukrishnan S.; RT "Expression and regulation of alpha-amylase gene family in barley RT aleurones"; RL J. Mol. Appl. Genet. 2(6):579-588(1984). XX DR GrainGenes; K02635; K02635. XX CC There are at least four types of alpha-amylase. The accumulation CC of alpha-amylase mRNAs in aleurones as a function of time after CC addition of the hormone gibberellic acid shows differential control CC of the expression of the alpha-amylase genes. XX FH Key Location/Qualifiers FH FT source 1..512 FT /organism="Hordeum vulgare" FT /mol_type="mRNA" FT /db_xref="taxon:4513" FT CDS <1..409 FT /codon_start=2 FT /note="alpha-amylase type B, EC 3.2.1.1" FT /db_xref="GOA:P04749" FT /db_xref="InterPro:IPR006047" FT /db_xref="InterPro:IPR012850" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="UniProtKB/Swiss-Prot:P04749" FT /protein_id="AAA32931.1" FT /translation="KAPGMIGWWPAKAVTFVNNHDTGSTQHMWPFPSDRVMQGYAYILT FT HQGTPCIFYDHFFDWGPKEEIDRLVSVSTRHGIHSESKLQIIEADADLCLAEIDGKVIV FT KLGPRYDVGNLIPGGFEVAAHGNDYAVWEKI" XX SQ Sequence 512 BP; 130 A; 137 C; 142 G; 103 T; 0 other; taaggcgcca ggcatgatcg ggtggtggcc agccaaggcg gtgacctttg tgaacaacca 60 cgacaccggc tccacgcagc acatgtggcc cttcccttct gacagggtca tgcagggata 120 tgcctacatc ctcacgcacc aagggacgcc atgcatcttc tacgatcatt tcttcgactg 180 gggcccgaag gaggagatcg atcgcctggt gtcagtcagt acccggcacg ggatacacag 240 cgagagcaag ctgcaaatca tagaggccga cgccgacctt tgtctcgccg agatcgacgg 300 caaggtcatc gtcaagctcg ggccaagata cgatgtgggg aacctcattc cgggaggctt 360 cgaggtggcc gcgcacggca atgactatgc cgtatgggag aaaatatgag caaaattgcg 420 agagcagctc tacaagttcc tatatgatac atattagtcc aagctcgcgc tgttcacata 480 gtacaattaa tactgctctg atgtaaaagt ga 512 // ![]() |