![]() |
EBI DbfetchID K02118; SV 1; linear; genomic DNA; STD; UNC; 293 BP. XX AC K02118; M27532; XX DT 13-JUN-1985 (Rel. 06, Created) DT 15-JAN-2007 (Rel. 90, Last updated, Version 4) XX DE Plasmid R67 from E.coli type II dihydrofolate-reductase (DHFR) gene, DE complete cds. XX KW dihydrofolate reductase; methotrexate-resistant; plasmid. XX OS Plasmid R67 OC other sequences; plasmids. OG Plasmid R67 XX RN [1] RP 1-293 RX DOI; 10.1016/0378-1119(84)90266-X RX PUBMED; 6735180. RA Brisson N., Hohn T.; RT "Nucleotide sequence of the dihydrofolate-reductase gene borne by the RT plasmid R67 and conferring methotrexate resistance"; RL Gene 28(2):271-274(1984). XX CC The type II dihydrofolate reductase (DHFR) enzymes are insensitive CC to methotrexate and trimethoprim and appear to have an origin CC distinct from other DHFRs. CC [1] compared sequences with another type II-DHFR enzyme, R388 (see CC separate entry), and found sequence homology of 75%, with most of CC the changes clustered in the 5' and 3' regions. Also reported in CC [1] was a modified gene sequence, designated R67' (see separate CC entry). After modification of the 3' end of the R67 gene, CC trimethoprim resistance in E.coli was observed to the same degree CC as in the unmodified gene. These findings support the idea that a CC conserved region of the gene may encode the active site of the CC protein. XX FH Key Location/Qualifiers FH FT source 1..293 FT /organism="Plasmid R67" FT /plasmid="R67" FT /mol_type="genomic DNA" FT /db_xref="taxon:2494" FT CDS 40..276 FT /codon_start=1 FT /transl_table=11 FT /note="dihydrofolate-reductase" FT /db_xref="GOA:P00383" FT /db_xref="InterPro:IPR008990" FT /db_xref="InterPro:IPR009159" FT /db_xref="PDB:1VIE" FT /db_xref="PDB:1VIF" FT /db_xref="PDB:2GQV" FT /db_xref="PDB:2P4T" FT /db_xref="PDB:2RH2" FT /db_xref="PDB:2RK1" FT /db_xref="PDB:2RK2" FT /db_xref="UniProtKB/Swiss-Prot:P00383" FT /protein_id="AAA26083.1" FT /translation="MERSSNEVSNPVAGNFVFPSNATFGMGDRVRKKSGAAWQGQIVGW FT YCTNLTPEGYAVESEAHPGSVQIYPVAALERIN" XX SQ Sequence 293 BP; 78 A; 71 C; 80 G; 64 T; 0 other; ccacatagaa cacctagaag ttcacaagaa aggtcggaaa tggaacgaag tagcaatgaa 60 gtcagtaatc cagttgctgg caattttgta ttcccatcga acgccacgtt tggtatggga 120 gatcgcgtgc gcaagaaatc cggcgccgcc tggcaaggtc agattgtcgg gtggtactgc 180 acaaatttga cccccgaagg ctacgccgtc gagtctgagg ctcacccagg ctcagtacag 240 atttatcctg ttgcggcgct tgaacgcatc aactgagttc aaggttgaag tgc 293 // ![]() |