spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   J01773; SV 1; linear; genomic DNA; STD; SYN; 1167 BP.
XX
AC   J01773;
XX
DT   13-JUN-1985 (Rel. 06, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Plasmid pMT100 from R388 type II dihydrofolate reductase (DHFR) gene, 1.17
DE   kb EcoRI-PvuII fragment.
XX
KW   dihydrofolate reductase; drug resistance protein; plasmid;
KW   trimethoprim resistance.
XX
OS   synthetic construct
OC   other sequences; artificial sequences.
XX
RN   [1]
RP   1-1167
RX   DOI; 10.1007/BF00428733
RX   PUBMED; 7022127.
RA   Swift G., McCarthy B.J., Heffron F.;
RT   "DNA sequence of a plasmid-encoded dihydrofolate reductase";
RL   Mol. Gen. Genet. 181(4):441-447(1981).
XX
CC   Dihydrofolate reductase (DHFR) is a highly conserved enzyme; the
CC   DHFRs encoded by the bacterial and animal genomes are similar to
CC   each other in size, amino acid sequence, and active site residues.
CC   In contrast, the plasmid-encoded type II DHFR and the bacterial
CC   chromosomal enzymes have different active sites and apparently
CC   distinct origins.
CC   Four BamHI linker insertion mutants were utilized as part of the
CC   sequencing strategy. Sites of insertion that destroyed the
CC   methotrexate resistance fell in two regions; one of these regions
CC   encodes a 78 amino acid polypeptide homologous to another
CC   drug-resistant DHFR, the second region essential for DHFR
CC   expression appears to be the promoter of the DHFR gene. The DHFR
CC   amino acid sequence derived from the DNA sequence is closely
CC   homologous to that of the R67 DHFR (see seperate entry), but
CC   differs in 17 of the 78 amino acid residues.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1167
FT                   /organism="synthetic construct"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:32630"
FT   CDS             809..1045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="dihydrofolate reductase"
FT                   /db_xref="GOA:P00384"
FT                   /db_xref="HSSP:1VIE"
FT                   /db_xref="InterPro:IPR009159"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00384"
FT                   /protein_id="AAA72145.1"
FT                   /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
FT                   YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
XX
SQ   Sequence 1167 BP; 259 A; 328 C; 331 G; 249 T; 0 other;
     cagctggcgc aggctgggtg ccaagctctc gggtaacatc aaggcccgat ccttggagcc        60
     cttgccctcc cgcacgatga tcgtgccgtg atcgaaatcc agatccttga cccgcagttg       120
     caaaccctca ctgatccgca tgcccgttcc atacagaagc tgggcgaaca aacgatgctc       180
     gccttccaga aaaccgagga tgcgaaccac ttcatccggg gtcagcacca ccggcaagcg       240
     ccgcgacggc cgaggtcttc cgatctccta agccaggcag atccgtgcac agcaccttgc       300
     cgtagaagaa cagcaaggcc gccaatgcct gacgatgcgt ggagaccgaa accttgcgct       360
     cgttcgccag ccagacagaa atgcctcgac ttcgctgctg cccaaggttg ccgggtgacg       420
     cacaccgtgg aaaccgatga aggcacgaac ccagttgaca taagcctgtt cggttcgtaa       480
     actgtaatgc aagtagcgta tgcgctcacg caactggtcc agaaccttga ccgaacgcag       540
     cggtggtaac ggcgcagtgg cggttttcat ggcttgttat gactgttttt ttgtacagtc       600
     tatgcctcgg gcatccaagc agcaagcgcg ttacgccgtg ggtcgatgtt tgatgttatg       660
     gagcagcaac gatgttacgc agcagggcag tcgccctaaa acaaagttag gcagccgttg       720
     tgctggtgct ttctgatagt tgttgtgggg taggcagtca gagttcgatt tgcttgtcgc       780
     cataatagat tcacaagaag gattcgacat gggtcaaagt agcgatgaag ccaacgctcc       840
     cgttgcaggg cagtttgcgc ttcccctgag tgccaccttt ggcttagggg atcgcgtacg       900
     caagaaatct ggtgccgctt ggcagggtca agtcgtcggt tggtattgca caaaactcac       960
     tcctgaaggc tatgcggtcg agtccgaatc ccacccaggc tcagtgcaaa tttatcctgt      1020
     ggctgcactt gaacgtgtgg cctaacaatt cgctccagcg gacggcttcg ccgcccgctg      1080
     agctttatcg ttaggcgtca tgggtcaaac gctcacaatc gaaccaagcg gcgagagtcg      1140
     cgggcactgc gactgctgtg ggaattc                                          1167
//
spacer
spacer