![]() |
EBI DbfetchID F14819; SV 1; linear; mRNA; EST; MAM; 207 BP. XX AC F14819; XX DT 30-AUG-1995 (Rel. 45, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 4) XX DE S.scrofa mRNA; expressed sequence tag (5'; clone c20f05) XX KW aldehyde dehydrogenase; EST; expressed sequence tag. XX OS Sus scrofa (pig) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. XX RN [1] RP 1-207 RX DOI; 10.1007/s003359900153 RX PUBMED; 8672129. RA Winteroe A.K., Fredholm M., Davies W.; RT "Evaluation and characterization of a porcine small intestine cDNA RT library"; RL Mamm. Genome 7(7):509-517(1996). XX RN [2] RP 1-207 RA Winteroe A.K.; RT ; RL Submitted (26-JUL-1995) to the EMBL/GenBank/DDBJ databases. RL Winteroe A.K., The Royal Veterinary and Agricultural University, Department RL of Animal Science and Animal Health, Division of Animal Genetics, Bulowsvej RL 13, 1870 Frederiksberg C, DENMARK XX DR UNILIB; 300; 324. XX FH Key Location/Qualifiers FH FT source 1..207 FT /organism="Sus scrofa" FT /mol_type="mRNA" FT /clone_lib="directionally cloned cDNA in XL1-blue MRF'" FT /clone="c20f05" FT /tissue_type="small intestine" FT /db_xref="taxon:9823" FT /db_xref="UNILIB:300" FT CDS <1..>207 FT /codon_start=1 FT /product="aldehyde dehydrogenase (NAD+)" FT /note="expressed sequence tag" FT /note="human homolog" FT /db_xref="GOA:Q29228" FT /db_xref="HSSP:1A4S" FT /db_xref="InterPro:IPR015590" FT /db_xref="UniProtKB/Swiss-Prot:Q29228" FT /protein_id="CAA23277.1" FT /translation="EPATGRVIATLTCSGEKEVNLAVQDAKAAFKIWSQKSGMERCRIL FT LEAARXIRERKEEIATMETINNGK" XX SQ Sequence 207 BP; 65 A; 38 C; 61 G; 42 T; 1 other; gagccggcaa ccggtcgagt gatagctact ttaacatgtt caggagaaaa ggaagtaaat 60 ttggctgttc aagatgcaaa ggctgccttt aaaatatgga gccagaaatc tggcatggag 120 cgttgccgaa ttcttttgga ggctgccagg ntaataaggg aacggaagga ggagatcgcc 180 accatggaga ccatcaacaa tggcaag 207 // ![]() |