![]() |
EBI DbfetchID EF376612; SV 1; linear; genomic RNA; STD; VRL; 297 BP. XX AC EF376612; XX DT 20-FEB-2007 (Rel. 90, Created) DT 30-JUN-2007 (Rel. 92, Last updated, Version 2) XX DE HIV-1 clone 77699R from Italy protease (pol) gene, partial cds. XX KW . XX OS Human immunodeficiency virus 1 OC Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; OC Lentivirus; Primate lentivirus group. XX RN [1] RP 1-297 RX DOI; 10.1086/518287 RX PUBMED; 17516412. RA Vicenti I., Razzolini F., Saladini F., Romano L., Zazzi M.; RT "Use of peripheral blood DNA for genotype antiretroviral resistance testing RT in drug-naive HIV-infected subjects"; RL Clin. Infect. Dis. 44(12):1657-1661(2007). XX RN [2] RP 1-297 RA Vicenti I., Razzolini F., Saladini F., Romano L., Zazzi M.; RT ; RL Submitted (19-JAN-2007) to the EMBL/GenBank/DDBJ databases. RL Department of Molecular Biology, University of Siena, Policlinico Le RL Scotte, Viale Bracci, Siena 53100, Italy XX FH Key Location/Qualifiers FH FT source 1..297 FT /organism="Human immunodeficiency virus 1" FT /isolate="patient 5371" FT /mol_type="genomic RNA" FT /country="Italy" FT /clone="77699R" FT /db_xref="taxon:11676" FT gene <1..>297 FT /gene="pol" FT CDS <1..>297 FT /codon_start=1 FT /gene="pol" FT /product="protease" FT /db_xref="GOA:A3FHF6" FT /db_xref="InterPro:IPR009007" FT /db_xref="UniProtKB/TrEMBL:A3FHF6" FT /protein_id="ABN55286.1" FT /translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPK FT MIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF" XX SQ Sequence 297 BP; 107 A; 47 C; 67 G; 75 T; 1 other; cctcaaatca ctctttggca acgacccctt gtcacaataa agataggggg gcagctaaag 60 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga 120 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat 180 cagatactca tagaaatctg tggacataaa gctataggta cagtattrgt aggacctaca 240 cctgtcaaca taattggaag aaacctgttg actcagattg gttgcacttt aaatttt 297 // ![]() |