EBI Dbfetch

ID   EF368567; SV 1; linear; genomic DNA; STD; VRL; 297 BP.
XX
AC   EF368567;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   27-NOV-2008 (Rel. 97, Last updated, Version 4)
XX
DE   HIV-1 isolate BCCFE_HOMER_HIV_PR_1257 from Canada protease (pol) gene,
DE   partial cds.
XX
KW   .
XX
OS   Human immunodeficiency virus 1
OC   Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae;
OC   Lentivirus; Primate lentivirus group.
XX
RN   [1]
RP   1-297
RX   DOI; 10.1371/journal.ppat.0030094
RX   PUBMED; 17616974.
RA   Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M.,
RA   Carlson J., Kadie C., Bhattacharya T., Chui C., Szinger J., Mo T.,
RA   Hogg R.S., Montaner J.S., Frahm N., Brander C., Walker B.D., Harrigan P.R.;
RT   "Evidence of differential HLA class I-mediated viral evolution in
RT   functional and accessory/regulatory genes of HIV-1";
RL   PLoS Pathog. 3(7):e94-e94(2007).
XX
RN   [2]
RP   1-297
RA   Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M.,
RA   Carlson J., Kadie C., Bhattacharya T., Chui C., Mo T., Hogg R.S.,
RA   Montaner J.S.G., Frahm N., Brander C., Walker B.D.;
RT   "In vivo HLA class-I-associated polymorphisms in HIV-1 identified through a
RT   genetic association approach correlate with clinical markers of immune
RT   decline";
RL   Unpublished.
XX
RN   [3]
RP   1-297
RA   Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M.,
RA   Carlson J., Kadie C., Bhattacharya T., Chui C., Mo T., Hogg R.S.,
RA   Montaner J.S.G., Frahm N., Brander C., Walker B.D.;
RT   ;
RL   Submitted (16-JAN-2007) to the EMBL/GenBank/DDBJ databases.
RL   B.C. Centre for Excellence in HIV/AIDS, University of British Columbia,
RL   613-1081 Burrard Street, Vancouver, BC V6Z 1Y6, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..297
FT                   /organism="Human immunodeficiency virus 1"
FT                   /isolate="BCCFE_HOMER_HIV_PR_1257"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada:British Columbia"
FT                   /isolation_source="chronically HIV-1 infected,
FT                   antiretroviral naive individual"
FT                   /proviral
FT                   /db_xref="taxon:11676"
FT   gene            <1..>297
FT                   /gene="pol"
FT   CDS             <1..>297
FT                   /codon_start=1
FT                   /gene="pol"
FT                   /product="protease"
FT                   /db_xref="GOA:A3FC11"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR018061"
FT                   /db_xref="UniProtKB/TrEMBL:A3FC11"
FT                   /protein_id="ABN47668.1"
FT                   /translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPK
FT                   MIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF"
XX
SQ   Sequence 297 BP; 106 A; 48 C; 68 G; 74 T; 1 other;
     cctcaaatca ctctttggca acgmcccctc gtcacaataa agataggggg gcagctaaag        60
     gaagctctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga       120
     agatggaagc caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat       180
     cagatactca tagaaatctg tggacataaa gctataggta cagtattagt aggacctaca       240
     cctgtcaaca taattggaag aaatctgttg actcagattg gctgcacttt aaatttt          297
//