![]() |
EBI DbfetchID EF368561; SV 1; linear; genomic DNA; STD; VRL; 297 BP. XX AC EF368561; XX DT 17-FEB-2007 (Rel. 90, Created) DT 27-NOV-2008 (Rel. 97, Last updated, Version 4) XX DE HIV-1 isolate BCCFE_HOMER_HIV_PR_1251 from Canada protease (pol) gene, DE partial cds. XX KW . XX OS Human immunodeficiency virus 1 OC Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; OC Lentivirus; Primate lentivirus group. XX RN [1] RP 1-297 RX DOI; 10.1371/journal.ppat.0030094 RX PUBMED; 17616974. RA Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M., RA Carlson J., Kadie C., Bhattacharya T., Chui C., Szinger J., Mo T., RA Hogg R.S., Montaner J.S., Frahm N., Brander C., Walker B.D., Harrigan P.R.; RT "Evidence of differential HLA class I-mediated viral evolution in RT functional and accessory/regulatory genes of HIV-1"; RL PLoS Pathog. 3(7):e94-e94(2007). XX RN [2] RP 1-297 RA Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M., RA Carlson J., Kadie C., Bhattacharya T., Chui C., Mo T., Hogg R.S., RA Montaner J.S.G., Frahm N., Brander C., Walker B.D.; RT "In vivo HLA class-I-associated polymorphisms in HIV-1 identified through a RT genetic association approach correlate with clinical markers of immune RT decline"; RL Unpublished. XX RN [3] RP 1-297 RA Brumme Z.L., Brumme C.J., Heckerman D., Korber B.T., Daniels M., RA Carlson J., Kadie C., Bhattacharya T., Chui C., Mo T., Hogg R.S., RA Montaner J.S.G., Frahm N., Brander C., Walker B.D.; RT ; RL Submitted (16-JAN-2007) to the EMBL/GenBank/DDBJ databases. RL B.C. Centre for Excellence in HIV/AIDS, University of British Columbia, RL 613-1081 Burrard Street, Vancouver, BC V6Z 1Y6, Canada XX FH Key Location/Qualifiers FH FT source 1..297 FT /organism="Human immunodeficiency virus 1" FT /isolate="BCCFE_HOMER_HIV_PR_1251" FT /mol_type="genomic DNA" FT /country="Canada:British Columbia" FT /isolation_source="chronically HIV-1 infected, FT antiretroviral naive individual" FT /proviral FT /db_xref="taxon:11676" FT gene <1..>297 FT /gene="pol" FT CDS <1..>297 FT /codon_start=1 FT /gene="pol" FT /product="protease" FT /db_xref="GOA:A3FC05" FT /db_xref="InterPro:IPR001969" FT /db_xref="InterPro:IPR001995" FT /db_xref="InterPro:IPR009007" FT /db_xref="InterPro:IPR018061" FT /db_xref="UniProtKB/TrEMBL:A3FC05" FT /protein_id="ABN47662.1" FT /translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPK FT MIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF" XX SQ Sequence 297 BP; 107 A; 48 C; 68 G; 74 T; 0 other; cctcagatca ctctttggca acgacccctc gtcacaataa agataggggg gcaactaaag 60 gaagctctat tagatacagg agcagatgac acagtattag aagaaatgaa tttgccagga 120 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat 180 cagatactta tagaaatctg tggacataaa gctataggta cagtattagt aggacctaca 240 cctgtcaaca taattggaag gaatctgttg actcagattg gttgcactct aaatttt 297 // ![]() |