![]() |
EBI DbfetchID DQ972955; SV 1; linear; mRNA; STD; MAM; 444 BP. XX AC DQ972955; XX DT 03-OCT-2006 (Rel. 89, Created) DT 24-DEC-2008 (Rel. 98, Last updated, Version 2) XX DE Sus scrofa UB2D2 mRNA, complete cds. XX KW . XX OS Sus scrofa (pig) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. XX RN [1] RP 1-444 RX DOI; 10.1007/s11033-007-9117-z RX PUBMED; 17610147. RA Liu G.Y., Gao S.Z., Ge C.R., Zhang X.; RT "Molecular characterization of the encoding regions and tissue expression RT analyses for three novel porcine genes--HNRPA1, YIPF5 and UB2D2"; RL Mol. Biol. Rep. 35(4):519-526(2008). XX RN [2] RP 1-444 RA Liu G.Y.; RT ; RL Submitted (25-AUG-2006) to the EMBL/GenBank/DDBJ databases. RL College of Animal Science, Kunming 650201, China XX FH Key Location/Qualifiers FH FT source 1..444 FT /organism="Sus scrofa" FT /mol_type="mRNA" FT /db_xref="taxon:9823" FT CDS 1..444 FT /codon_start=1 FT /product="UB2D2" FT /db_xref="GOA:Q06AA9" FT /db_xref="InterPro:IPR000608" FT /db_xref="UniProtKB/Swiss-Prot:Q06AA9" FT /protein_id="ABI96191.1" FT /translation="MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPY FT QGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLL FT SICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM" XX SQ Sequence 444 BP; 134 A; 102 C; 84 G; 124 T; 0 other; atggctctga agagaatcca caaggaattg aacgacctgg cccgtgaccc tccagcacaa 60 tgttctgcag gtccagttgg ggatgatatg tttcattggc aagccacaat tatgggacct 120 aatgacagcc catatcaagg tggtgtattc tttttgacaa ttcattttcc tacagactac 180 cccttcaaac cacctaaggt tgcatttaca acaagaattt atcatccaaa tattaacagt 240 aatggcagca tttgtctcga tattctaaga tcacagtggt ctcctgcttt aactatttct 300 aaagttcttt tatccatttg ttcactgcta tgtgatccaa acccagatga ccccctagtg 360 ccagagattg cacggatcta caaaacagac agagataagt acaacagaat atctcgggaa 420 tggactcaga agtatgccat gtga 444 // ![]() |