![]() |
EBI DbfetchID D73437; SV 1; linear; genomic DNA; STD; PRO; 351 BP. XX AC D73437; XX DT 18-MAY-1996 (Rel. 47, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Acinetobacter sp. gene for DNA gyrase subunit B protein, N terminal side, DE partial cds. XX KW DNA gyrase subunit B protein. XX OS Acinetobacter sp. OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Moraxellaceae; Acinetobacter. XX RN [1] RP 1-351 RA Yamamoto S.; RT ; RL Submitted (30-SEP-1995) to the EMBL/GenBank/DDBJ databases. RL Satoshi Yamamoto, Marine Biothechnology Institute, Kamaishi Laboratories; RL 3-75-1 Heita, Kamaishi, Iwate 026, Japan (E-mail:HGD02251@niftyserve.or.jp, RL Tel:0193-26-6538, Fax:0193-26-6584) XX RN [2] RP 1-351 RA Yamamoto S.; RT ; RL Unpublished. XX RN [3] RX PUBMED; 8934907. RA Yamamoto S., Harayama S.; RT "Phylogenetic analysis of Acinetobacter strains based on the nucleotide RT sequences of gyrB genes and on the amino acid sequences of their products"; RL Int. J. Syst. Bacteriol. 46(2):506-511(1996). XX DR StrainInfo; 51612; ATCC 11171. XX FH Key Location/Qualifiers FH FT source 1..351 FT /organism="Acinetobacter sp." FT /strain="CIP 63.46 (=ATCC 11171)" FT /mol_type="genomic DNA" FT /note="correspond to pos.320-673 in E.coli K-12 gyrB gene FT (X04341, X00870)" FT /db_xref="taxon:472" FT CDS <1..>351 FT /codon_start=3 FT /transl_table=11 FT /gene="gyrB" FT /product="DNA gyrase subunit B protein" FT /db_xref="GOA:Q44274" FT /db_xref="InterPro:IPR001241" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR013506" FT /db_xref="InterPro:IPR013760" FT /db_xref="InterPro:IPR014721" FT /db_xref="InterPro:IPR018522" FT /db_xref="InterPro:IPR020568" FT /db_xref="UniProtKB/Swiss-Prot:Q44274" FT /protein_id="BAA11162.1" FT /translation="SYKVSGGLHGVGVSVVNALSSKLELTIHRAGHIHQQEYKHGDPVY FT PLKIVGDVETTGTIVRFWPSTETFSQTIFNVDILARRLRELSFLNAGVRIVLRDERVAL FT EHVFDYEGGLSE" XX SQ Sequence 351 BP; 90 A; 63 C; 82 G; 116 T; 0 other; atagctataa agtttcaggc ggtttgcacg gcgtaggtgt atctgtagtt aatgcacttt 60 caagcaaact tgaacttacg attcatcgtg ctggtcatat tcatcaacaa gaatataaac 120 atggtgatcc ggtttatccg ttaaaaattg tgggtgatgt cgaaaccaca gggaccattg 180 ttcgtttctg gccaagtact gaaacgttta gccaaacgat ttttaatgtc gatattttgg 240 cacgtcgctt acgtgaactt tcattcttga atgcgggtgt tcgtattgtc ctacgtgatg 300 aacgtgttgc cttagaacat gtcttcgatt acgaaggtgg gttatctgag t 351 // ![]() |