![]() |
EBI DbfetchID D73436; SV 1; linear; genomic DNA; STD; PRO; 351 BP. XX AC D73436; XX DT 18-MAY-1996 (Rel. 47, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Acinetobacter sp. gene for DNA gyrase subunit B protein, N terminal side, DE partial cds. XX KW DNA gyrase subunit B protein. XX OS Acinetobacter sp. OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Moraxellaceae; Acinetobacter. XX RN [1] RP 1-351 RA Yamamoto S.; RT ; RL Submitted (30-SEP-1995) to the EMBL/GenBank/DDBJ databases. RL Satoshi Yamamoto, Marine Biothechnology Institute, Kamaishi Laboratories; RL 3-75-1 Heita, Kamaishi, Iwate 026, Japan (E-mail:HGD02251@niftyserve.or.jp, RL Tel:0193-26-6538, Fax:0193-26-6584) XX RN [2] RP 1-351 RA Yamamoto S.; RT ; RL Unpublished. XX RN [3] RX PUBMED; 8934907. RA Yamamoto S., Harayama S.; RT "Phylogenetic analysis of Acinetobacter strains based on the nucleotide RT sequences of gyrB genes and on the amino acid sequences of their products"; RL Int. J. Syst. Bacteriol. 46(2):506-511(1996). XX DR StrainInfo; 1470; ATCC 17924. XX FH Key Location/Qualifiers FH FT source 1..351 FT /organism="Acinetobacter sp." FT /strain="CIP 70.12 (=ATCC 17924)" FT /mol_type="genomic DNA" FT /note="correspond to pos.320-673 in E.coli K-12 gyrB gene FT (X04341, X00870)" FT /db_xref="taxon:472" FT CDS <1..>351 FT /codon_start=3 FT /transl_table=11 FT /gene="gyrB" FT /product="DNA gyrase subunit B protein" FT /db_xref="GOA:Q44273" FT /db_xref="InterPro:IPR001241" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR013759" FT /db_xref="InterPro:IPR013760" FT /db_xref="InterPro:IPR018522" FT /db_xref="UniProtKB/Swiss-Prot:Q44273" FT /protein_id="BAA11161.1" FT /translation="SYKVSGGLHGVGVSVVNALSSKLELTIHRAGHIHQQEYKHGDPVY FT PLKVIGDIETTGTTVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDERVAL FT EHIFDLEVGLSE" XX SQ Sequence 351 BP; 94 A; 64 C; 84 G; 109 T; 0 other; acagctataa agtatcaggt ggtttgcatg gtgtaggtgt ttcggtcgta aatgcactat 60 cgagcaaact tgaattaacg atccaccgtg ctgggcatat tcaccaacaa gaatacaaac 120 atggtgatcc tgtatatccc ttgaaagtga tcggtgatat tgaaacaaca ggaaccactg 180 tgcgtttctg gccaagtgca gaaaccttca gtcaaacgat ttttaatgtg gatattttgg 240 cacgtcgttt acgtgagctg tcattcttaa atgctggtgt acgtattgtt cttcgagacg 300 aacgtgtcgc tttagagcat atcttcgatt tggaggtggg tttatctgaa t 351 // ![]() |