![]() |
EBI DbfetchID D73421; SV 1; linear; genomic DNA; STD; PRO; 300 BP. XX AC D73421; XX DT 18-MAY-1996 (Rel. 47, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 6) XX DE Acinetobacter sp. gene for DNA gyrase subunit B protein, C terminal side, DE partial cds. XX KW DNA gyrase subunit B protein. XX OS Acinetobacter sp. OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; OC Moraxellaceae; Acinetobacter. XX RN [1] RP 1-300 RA Yamamoto S.; RT ; RL Submitted (30-SEP-1995) to the EMBL/GenBank/DDBJ databases. RL Satoshi Yamamoto, Marine Biothechnology Institute, Kamaishi Laboratories; RL 3-75-1 Heita, Kamaishi, Iwate 026, Japan (E-mail:HGD02251@niftyserve.or.jp, RL Tel:0193-26-6538, Fax:0193-26-6584) XX RN [2] RP 1-300 RA Yamamoto S.; RT ; RL Unpublished. XX RN [3] RX PUBMED; 8934907. RA Yamamoto S., Harayama S.; RT "Phylogenetic analysis of Acinetobacter strains based on the nucleotide RT sequences of gyrB genes and on the amino acid sequences of their products"; RL Int. J. Syst. Bacteriol. 46(2):506-511(1996). XX DR StrainInfo; 1470; ATCC 17924. XX FH Key Location/Qualifiers FH FT source 1..300 FT /organism="Acinetobacter sp." FT /strain="CIP 70.12 (=ATCC 17924)" FT /mol_type="genomic DNA" FT /note="correspond to pos.1183-1482 in E.coli K-12 gyrB gene FT (X04341, X00870)" FT /db_xref="taxon:472" FT CDS <1..>300 FT /codon_start=1 FT /transl_table=11 FT /gene="gyrB" FT /product="DNA gyrase subunit B protein" FT /db_xref="GOA:Q44273" FT /db_xref="InterPro:IPR001241" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR013759" FT /db_xref="InterPro:IPR013760" FT /db_xref="InterPro:IPR018522" FT /db_xref="UniProtKB/Swiss-Prot:Q44273" FT /protein_id="BAA11146.1" FT /translation="KSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRK FT MQAILPLKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKII" XX SQ Sequence 300 BP; 92 A; 54 C; 74 G; 80 T; 0 other; aaaagtgcgc ttgatattgc gggtttacca ggtaaattgg cagattgcca agaaaaagat 60 ccagcacttt ctgaattata cttggtcgag ggtgactctg cgggcggttc tgcaaagcag 120 ggacgtaatc gtaagatgca agccattctt ccattaaagg gtaaaattct caatgtcgag 180 cgtgctcgat tcgacaagat gatttcatct caagaagtgg gaacgctgat tactgcacta 240 ggatgtggta ttgggcgtga agaatataat ccagacaaat tacgctatca taaaatcatt 300 // ![]() |