![]() |
EBI DbfetchID D38080; SV 1; linear; genomic DNA; STD; PRO; 429 BP. XX AC D38080; XX DT 28-SEP-1994 (Rel. 41, Created) DT 16-FEB-2008 (Rel. 94, Last updated, Version 7) XX DE Geobacillus stearothermophilus gene for DNA binding protein HU, complete DE cds. XX KW . XX OS Geobacillus stearothermophilus OC Bacteria; Firmicutes; Bacillales; Bacillaceae; Geobacillus. XX RN [1] RP 1-429 RA Kimura M.; RT ; RL Submitted (27-AUG-1994) to the EMBL/GenBank/DDBJ databases. RL Contact:Makoto Kimura Faculty of Agriculture, Kyushu University, Laboratory RL of Biochemistry; 6-10-1 Hakozaki, Higashi-ku, Fukuoka, Fukuoka 812, Japan XX RN [2] RA Kawamura S., Kajiyama H., Yamasaki N., Kimura M.; RT "Cloning of the gene encoding DNA binding protein HU from Bacillus RT stearothermophilus and its expression in Escherichia coli"; RL Biosci. Biotechnol. Biochem. 59:126-129(1994). XX FH Key Location/Qualifiers FH FT source 1..429 FT /organism="Geobacillus stearothermophilus" FT /strain="1503" FT /mol_type="genomic DNA" FT /note="synonym: Bacillus stearothermophilus" FT /db_xref="taxon:1422" FT RBS 1..7 FT CDS 13..285 FT /codon_start=1 FT /transl_table=11 FT /product="DNA binding protein HU" FT /db_xref="GOA:P0A3H0" FT /db_xref="InterPro:IPR000119" FT /db_xref="PDB:1HUE" FT /db_xref="UniProtKB/Swiss-Prot:P0A3H0" FT /protein_id="BAA07273.1" FT /translation="MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLI FT GFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK" FT terminator 297..339 XX SQ Sequence 429 BP; 127 A; 86 C; 118 G; 98 T; 0 other; aggaggtaat gcatgaacaa aacggaattg atcaatgcgg tcgctgaaac aagcggtctt 60 tccaaaaaag atgcgacaaa agccgttgat gcggtgtttg attcgattac agaagcgctg 120 cgaaaaggcg ataaagtgca attaatcggt tttggaaact ttgaagtgcg cgagcgcgcc 180 gcccggaaag gacgcaaccc gcaaacgggc gaagaaatgg aaattccggc aagcaaagtt 240 cctgcattca aaccgggcaa agcattgaaa gatgccgtca agtaagctac atagcaggag 300 cgcaggaggg aagggcaggt gatccaccgg cccttctttt ttgttttttt tggctcccta 360 tgctacaatc ggattacatg cagcttttat gatgcaggag gatgttgttt gtatgccaga 420 gatcaattt 429 // ![]() |