 |
|
EBI DbfetchID D16150; SV 1; linear; mRNA; STD; VRT; 3381 BP. XX AC D16150; XX DT 28-APR-1995 (Rel. 43, Created) DT 15-JAN-2003 (Rel. 74, Last updated, Version 6) XX DE Gallus gallus IREBP mRNA for iron responsive element binding protein, DE complete cds. XX KW . XX OS Gallus gallus (chicken) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; OC Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. XX RN [1] RP 1-3381 RA Kunita R.; RT ; RL Submitted (30-APR-1993) to the EMBL/GenBank/DDBJ databases. RL Ryota Kunita, Tohoku University, Applied Biological Chemistry; 1-1 RL Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai, Miyagi 981, Japan RL (E-mail:a21668@cctu.cc.tohoku.ac.jp, Tel:81-22-272-4321(ex.271), RL Fax:81-22-272-1870) XX RN [2] RP 1-3381 RX DOI; 10.1007/BF00710129 RX PUBMED; 8156162. RA Saitoh Y., Ogawa A., Hori T., Kunita R., Mizuno S.; RT "Identification and localization of two genes on the chicken Z chromosome: RT implication of evolutionary conservation of the Z chromosome among avian RT species"; RL Chromosome Res. 1(4):239-251(1993). XX DR Ensembl-Gn; ENSGALG00000002162; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002180; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000002883; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003150; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003162; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000003182; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000005587; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006272; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000006623; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000007380; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000008701; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000021047; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000023787; Gallus_gallus. DR Ensembl-Gn; ENSGALG00000023800; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001421; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000001427; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000003386; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000003414; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000004548; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000004988; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000005002; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000005049; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000008973; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010137; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000010690; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000011640; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000011641; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000011935; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000014160; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000034593; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039817; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039819; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039836; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039837; Gallus_gallus. DR Ensembl-Tr; ENSGALT00000039848; Gallus_gallus. XX FH Key Location/Qualifiers FH FT source 1..3381 FT /organism="Gallus gallus" FT /chromosome="Z" FT /sub_species="domesticus" FT /mol_type="mRNA" FT /dev_stage="40-days old" FT /clone="pCIREBP" FT /tissue_type="liver" FT /db_xref="taxon:9031" FT CDS 54..2723 FT /codon_start=1 FT /gene="IREBP" FT /product="Iron responsive element binding protein" FT /db_xref="GOA:Q90875" FT /db_xref="InterPro:IPR000573" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR006249" FT /db_xref="InterPro:IPR015928" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015932" FT /db_xref="InterPro:IPR015934" FT /db_xref="InterPro:IPR015937" FT /db_xref="InterPro:IPR018136" FT /db_xref="UniProtKB/Swiss-Prot:Q90875" FT /protein_id="BAA03715.1" FT /translation="MSNPFVQIVEPLDAKEPVKKFFNLSKLEDVRYARLPFSIRVLLEA FT AIRNCDEFLVKKQDVENILNWKVMQHKNVEVPFKPARVILQDFTGVPAVVDFAAMRDAV FT KKLGGDPEKINPICPADLVIDHSIQVDFNRRSDSLQKNQDLEFERNKERFEFLKWGSQA FT FKNMRIIPPGSGIIHQVNLEYLARVVMDQDGYYYPDSVVGTDSHTTMVDGLGVLGWGVG FT GIEAEAVMLGQPISMVLPEVVGYKLLGNPQPLVTSTDIVLTITKHLRQVGVVGKFVEFF FT GPGVAQLSIADRATIANMCPEYGATAAYFPVDDISIGYLVQTGRDKEKVLCTKKYLEAV FT GMLRDFKNSSQDPDFTQVVELDLHTVVPCCSGPKRPQDKVAVSDMKKDFETCLGAKQGF FT KGFQIAPDRHNSVIKFNFEGCDFELAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVE FT AGLTVKPYIKTSLSPGSGVVTYYLRESGVMSYLSQLGFDVVGYGCMTCIGNSGPLPDSV FT VEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLG FT ISASGKKIFLKDIWPTRNEIQAVERQYVIPGMFKEVYQKIETVNEAWNALDAPSDKLYT FT WNPKSTYIKSPPFFDGLTLALQTPKTIEDAYVLLNFGDSVTTDHISPAGNIARNSPAAR FT YLTSRGLTPREFNSYGSRRGNDAVMARGTFANIRLVNKFIDKQGPQTIHFPSGETLDVF FT DAAERYKQAGHPLIVLAGKEYGAGSSRDWAAKGPFLLGVKAVLAESYERIHRSNLVGMG FT VIPLQYLPGEDARTLGLTGRERYTIIIPENLKPQMNIQIKLDTGKTFHAIMRFDTDVEL FT TYFHNGGILNYMIRKMAS" FT polyA_signal 3361..3366 XX SQ Sequence 3381 BP; 940 A; 673 C; 814 G; 954 T; 0 other; ggcggcgctc cgttcctccg agctccacgg gacacaaggt gtcgttaaga accatgagca 60 acccttttgt acagattgtt gagccactgg atgctaaaga gcctgtgaag aagttcttta 120 atctgagcaa attggaagat gtgagatatg cacgtcttcc attttctatt cgagtcctct 180 tggaagcagc gatccgaaac tgtgatgagt tcctagtgaa gaagcaagat gttgagaata 240 ttctcaactg gaaagtgatg caacacaaga atgttgaagt gccatttaag cctgcacgag 300 ttattctgca agatttcact ggggtacctg ctgttgttga ctttgctgca atgcgtgatg 360 ctgtgaagaa acttggtggg gaccctgaaa aaatcaatcc tatctgtcct gctgatctag 420 tgatagatca ctccatccag gttgatttta acaggcgatc agacagcttg caaaagaatc 480 aggacttgga atttgaaagg aacaaagaaa ggtttgagtt cttaaagtgg ggctctcagg 540 cttttaaaaa catgaggatt attccaccag gctctgggat catccaccaa gtgaacctgg 600 aatacttagc aagagtggtg atggatcagg atggctacta ctatcccgac agtgtggtgg 660 gcactgactc gcacaccacc atggtagatg gcttgggagt acttggctgg ggtgttggtg 720 gcattgaagc agaagcagtg atgttgggcc agccaattag catggtgctt ccagaagtgg 780 ttggctataa gctgctagga aaccctcagc cactcgtaac atccactgac atagtgctca 840 ctattaccaa gcaccttcgc caagttggag tcgtgggtaa atttgtggag ttttttggtc 900 ctggtgtagc ccagctgtca attgctgacc gagccaccat tgccaatatg tgtccagagt 960 atggagcaac agctgcctat ttcccagtgg atgatattag cattggatac ctggtgcaaa 1020 caggccgtga taaagagaaa gttctgtgca caaaaaagta tcttgaggct gtgggaatgc 1080 tgagagattt caagaactcc tctcaggatc cagacttcac acaggttgtt gagttggatc 1140 ttcatactgt tgtgccttgc tgcagcggac caaaaagacc ccaggacaaa gttgctgtgt 1200 cagatatgaa gaaggacttt gagacttgtc tgggagcaaa gcaaggattc aagggattcc 1260 agattgcccc ggatcgacac aacagtgtaa tcaaatttaa ctttgagggc tgcgactttg 1320 aactagctca tggttcagta gtgattgctg ccattacaag ctgtactaat accagtaacc 1380 cctcagtcat gttgggagca ggattgcttg ccaagaaagc tgttgaagct ggtttgacag 1440 tgaagcctta cattaaaact agcctgtctc caggaagtgg cgttgtcact tactatctga 1500 gagagagtgg agtcatgagc tacctttctc agctagggtt tgatgtagtg ggttatggct 1560 gtatgacttg tattggcaat agtggacccc tgccagactc tgttgttgaa gccattacac 1620 agggagacct tgtagcagtg ggtgttttgt ccggcaacag gaactttgaa gggcgtgtgc 1680 atcccaacac ccgtgctaac tacctagcct ctccaccact ggtgatagcc tatgcaattg 1740 caggaactgt ccggattgac tttgagaaag agcctttggg gataagtgct tcagggaaga 1800 agattttcct gaaagacatc tggccaacaa gaaatgagat acaggctgtt gaacgtcagt 1860 atgttattcc tgggatgttc aaggaggtct accaaaaaat agagacagta aatgaagctt 1920 ggaatgcttt agatgctccc tcagacaagc tatatacttg gaatccaaag tcaacataca 1980 tcaagtctcc gcctttcttt gatggtctga ctttggctct gcagacaccc aaaactatag 2040 aagatgctta tgtcctgttg aattttggag attctgtgac aacggaccac atatctccag 2100 ctgggaatat agcaaggaat agtcctgcag cccgttattt gaccagcaga ggcttgactc 2160 ctcgagagtt caattcctat ggttctcgca gagggaatga tgctgtcatg gccagaggaa 2220 catttgcaaa cattcgtctg gtgaacaaat ttattgataa acagggacct cagactatcc 2280 atttcccttc aggagaaaca ctggacgtgt ttgatgctgc tgaaagatac aagcaggctg 2340 gtcatccttt gattgtgctg gctgggaagg aatatggtgc aggaagctca agagactggg 2400 cagccaaagg gccgttcctc ttgggcgtca aggctgtgct tgctgaaagc tatgagagaa 2460 ttcatcggag caaccttgta gggatgggag tgattcctct gcaatattta cctggggagg 2520 atgcaaggac tttaggactc actggaagag aacgttacac aattataatt cctgaaaatc 2580 taaaaccaca gatgaatatc cagatcaagc tggataccgg gaaaaccttt catgccatca 2640 tgaggtttga cactgacgtg gaactcactt acttccacaa tggcggtatt ctgaactaca 2700 tgattcgtaa gatggcgtcg taatcaaaag cactgagcac agcctcgcag gtacaggcct 2760 gcttctggtg agcacgacaa aactaatcag taataatgaa gtcagaagag tgaaccataa 2820 agtgaacagt ggtttgttgg attttttgtt gttgttgttc atttcttctt tttgttcttt 2880 taaacaagcc ttttgaaagg cttgctgacc atgctgaatg attctctata tcaggaaact 2940 tgtcactttt gcccattaaa gaaaacaact tcttcttagt tttgaatggc aattgaaaat 3000 tgtagttggc ttgacttacc ttagaacact gtgcaaaagt cattaaaata ctggcagaat 3060 ctgtggaact gttgaagatc atatgctggt tttatgtatt tggtccattt cttttaactg 3120 ctaagttcag ttctgcattt tattagtggt ccaaaaacta actgacagta tgcatttaat 3180 ttttattcct tcctgatttt ctgatattga cttcctttct tactcagctg accagattct 3240 gaatctaata ctgaaattaa tcatctagct gtttattaat tcaaaagaaa atgtgaactc 3300 cgttctttaa actgtaagcc tttgtggaaa ggtggaccta tggggataat atttctaatg 3360 aataaaatta aacttatttt c 3381 // |
|