![]() |
EBI DbfetchID CR457052; SV 1; linear; mRNA; STD; HUM; 231 BP. XX AC CR457052; XX DT 03-JUN-2004 (Rel. 80, Created) DT 03-JUN-2004 (Rel. 80, Last updated, Version 1) XX DE Homo sapiens full open reading frame cDNA clone RZPDo834E027D for gene DE PKIA, protein kinase (cAMP-dependent, catalytic) inhibitor alpha; complete DE cds, incl. stopcodon. XX KW Full ORF shuttle clone, Gateway(TM), complete cds. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-231 RA Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.; RT "Cloning of human full open reading frames in Gateway(TM) system entry RT vector (pDONR201)"; RL Unpublished. XX RN [2] RP 1-231 RA Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.; RT ; RL Submitted (03-JUN-2004) to the EMBL/GenBank/DDBJ databases. RL RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer RL Feld 580, D-69120 Heidelberg, Germany XX DR ASTD; TRAN00000077391. DR H-InvDB; HIT000267902. DR ImaGenes; RZPDe860E027D. XX CC RZPD; RZPDo834E027D, ORFNo 1659 CC www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E027D CC RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) CC RZPD LIB No. 834 CC www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 CC www.rzpd.de/products/orfclones/ CC Contact: Inge Arlart CC RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, CC Heubnerweg 6, D-14059 Berlin, Germany CC Tel: +49 30 32639 100 CC Fax: +49 30 32639 111 CC www.rzpd.de CC This clone is available from RZPD; CC contact RZPD (customer.service@rzpd.de) for further information. CC CC This CDS clone is a part of a collection of human full length CC expression clones generated by RZPD. CC This CDS has been cloned incl. stopcodon. CC The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. CC Additional sequence has been added in front of the start codon: CC att..AAAAAA GCA GGC (ATG). CC The last base of the last coding triplett has been changed to T, CC which might lead to an amino acid change at the C terminus of the CC polypeptide. CC The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. CC Compared to the reference sequence NM_006823 we did not find any CC amino acid exchanges. CC Clone distribution: http://www.rzpd.de/products/orfclones/ XX FH Key Location/Qualifiers FH FT source 1..231 FT /organism="Homo sapiens" FT /lab_host="DH10B" FT /mol_type="mRNA" FT /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" FT /clone="RZPDo834E027D" FT /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" FT /db_xref="taxon:9606" FT CDS 1..231 FT /codon_start=1 FT /gene="PKIA" FT /db_xref="GOA:P61925" FT /db_xref="HGNC:9017" FT /db_xref="InterPro:IPR004171" FT /db_xref="PDB:1CMK" FT /db_xref="PDB:1JLU" FT /db_xref="PDB:1Q8T" FT /db_xref="PDB:1VEB" FT /db_xref="PDB:1XH4" FT /db_xref="PDB:1XH5" FT /db_xref="PDB:1XH6" FT /db_xref="PDB:1XH7" FT /db_xref="PDB:1XH8" FT /db_xref="PDB:1XH9" FT /db_xref="PDB:1XHA" FT /db_xref="PDB:1YDR" FT /db_xref="PDB:2C1A" FT /db_xref="PDB:2C1B" FT /db_xref="PDB:2F7E" FT /db_xref="PDB:2GNI" FT /db_xref="PDB:2JDS" FT /db_xref="PDB:2JDT" FT /db_xref="PDB:2JDV" FT /db_xref="PDB:2UVX" FT /db_xref="PDB:2UVY" FT /db_xref="PDB:2UVZ" FT /db_xref="PDB:2UW0" FT /db_xref="PDB:2UW3" FT /db_xref="PDB:2UW4" FT /db_xref="PDB:2UW5" FT /db_xref="PDB:2UW6" FT /db_xref="PDB:2UW7" FT /db_xref="PDB:2UW8" FT /db_xref="PDB:2VNW" FT /db_xref="PDB:2VNY" FT /db_xref="PDB:2VO0" FT /db_xref="PDB:2VO3" FT /db_xref="PDB:2VO6" FT /db_xref="PDB:2VO7" FT /db_xref="UniProtKB/Swiss-Prot:P61925" FT /protein_id="CAG33333.1" FT /translation="MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGL FT DINKTEGEEDAQRSSTEQSGEAQGEAAKSES" XX SQ Sequence 231 BP; 88 A; 37 C; 56 G; 50 T; 0 other; atgactgatg tggaaactac atatgcagat tttattgctt caggaagaac aggtagaaga 60 aatgcaatac atgatatcct ggtttcctct gcaagtggca acagcaatga attagccttg 120 aaattagcag gtcttgatat caacaagaca gaaggtgaag aagatgcaca acgaagttct 180 acagaacaaa gtggggaagc ccagggagaa gcagcaaaat ctgaaagtta a 231 // ![]() |