![]() |
EBI DbfetchID CR456879; SV 1; linear; mRNA; STD; HUM; 273 BP. XX AC CR456879; XX DT 03-JUN-2004 (Rel. 80, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Homo sapiens full open reading frame cDNA clone RZPDo834A017D for gene DE AF1Q, ALL1-fused gene from chromosome 1q; complete cds, incl. stopcodon. XX KW Full ORF shuttle clone, Gateway(TM), complete cds. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-273 RA Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.; RT "Cloning of human full open reading frames in Gateway(TM) system entry RT vector (pDONR201)"; RL Unpublished. XX RN [2] RP 1-273 RA Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.; RT ; RL Submitted (03-JUN-2004) to the EMBL/GenBank/DDBJ databases. RL RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer RL Feld 580, D-69120 Heidelberg, Germany XX DR H-InvDB; HIT000267729. DR ImaGenes; RZPDe860A017D. XX CC RZPD; RZPDo834A017D, ORFNo 1199 CC www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A017D CC RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) CC RZPD LIB No. 834 CC www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 CC www.rzpd.de/products/orfclones/ CC Contact: Inge Arlart CC RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, CC Heubnerweg 6, D-14059 Berlin, Germany CC Tel: +49 30 32639 100 CC Fax: +49 30 32639 111 CC www.rzpd.de CC This clone is available from RZPD; CC contact RZPD (customer.service@rzpd.de) for further information. CC CC This CDS clone is a part of a collection of human full length CC expression clones generated by RZPD. CC This CDS has been cloned incl. stopcodon. CC The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. CC Additional sequence has been added in front of the start codon: CC att..AAAAAA GCA GGC (ATG). CC The last base of the last coding triplett has been changed to T, CC which might lead to an amino acid change at the C terminus of the CC polypeptide. CC The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. CC Compared to the reference sequence NM_006818 we did not find any CC amino acid exchanges. CC Clone distribution: http://www.rzpd.de/products/orfclones/ XX FH Key Location/Qualifiers FH FT source 1..273 FT /organism="Homo sapiens" FT /lab_host="DH10B" FT /mol_type="mRNA" FT /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" FT /clone="RZPDo834A017D" FT /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" FT /db_xref="taxon:9606" FT CDS 1..273 FT /codon_start=1 FT /gene="AF1Q" FT /db_xref="GOA:Q13015" FT /db_xref="HGNC:16997" FT /db_xref="UniProtKB/Swiss-Prot:Q13015" FT /protein_id="CAG33160.1" FT /translation="MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSV FT GKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL" XX SQ Sequence 273 BP; 71 A; 73 C; 70 G; 59 T; 0 other; atgagggacc ctgtgagtag ccagtacagt tcctttcttt tctggaggat gcccatccca 60 gaactggatc tgtcggagct ggaaggcctg ggtctgtcag atacagccac ctacaaggtc 120 aaagacagca gcgttggcaa aatgatcggg caagcaactg cagcagacca ggagaaaaac 180 cctgaaggtg atggcctcct tgagtacagc accttcaact tctggagagc tcccattgcc 240 agcatccact ccttcgaact ggacttgctt taa 273 // ![]() |