![]() |
EBI DbfetchID BT044519; SV 1; linear; mRNA; STD; INV; 1105 BP. XX AC BT044519; XX DT 18-SEP-2008 (Rel. 97, Created) DT 18-SEP-2008 (Rel. 97, Last updated, Version 1) XX DE Drosophila melanogaster FI08434 full insert cDNA. XX KW FLI_CDNA. XX OS Drosophila melanogaster (fruit fly) OC Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; OC Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; OC Drosophilidae; Drosophila; Sophophora. XX RN [1] RP 1-1105 RA Carlson J., Booth B., Frise E., Park S., Wan K., Yu C., Celniker S.; RT ; RL Submitted (16-SEP-2008) to the EMBL/GenBank/DDBJ databases. RL Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, RL One Cyclotron Road, Berkeley, CA 94720, USA XX DR FLYBASE; FBgn0039258; beta4GalT7. XX CC Sequence submitted by: CC Berkeley Drosophila Genome Project CC Lawrence Berkeley National Laboratory CC Berkeley, CA 94720 CC This clone was sequenced as part of a high-throughput process to CC sequence clones from the Drosophila Gene Collection The sequence CC has been subjected to integrity checks for sequence accuracy, CC presence of a polyA tail and contiguity within 100 kb in the CC genome. Thus we believe the sequence to reflect accurately this CC particular cDNA clone. However, there are artifacts associated with CC the generation of cDNA clones that may have not been detected in CC our initial analyses such as internal priming, priming from CC contaminating genomic DNA, retained introns due to reverse CC transcription of unspliced precursor RNAs, and reverse CC transcriptase errors that result in single base changes. For CC further information about this sequence, including its location and CC relationship to other sequences, please visit our Web site CC (http://www.fruitfly.org) or send email to cdna@fruitfly.org. XX FH Key Location/Qualifiers FH FT source 1..1105 FT /organism="Drosophila melanogaster" FT /mol_type="mRNA" FT /db_xref="taxon:7227" FT gene 1..1105 FT /map="3R" FT /gene="beta4GalT7-RA" FT CDS 98..1066 FT /codon_start=1 FT /gene="beta4GalT7-RA" FT /product="FI08434p" FT /note="Longest ORF" FT /db_xref="GOA:Q9VBZ9" FT /db_xref="HSSP:1NMM" FT /db_xref="InterPro:IPR003859" FT /db_xref="UniProtKB/TrEMBL:Q9VBZ9" FT /protein_id="ACH95293.1" FT /translation="MVNISTINWVFVCGLSFCLGGIAVLSLMPLGSDCVCPLSNPLAKL FT AGGGEGVSVIKKEPADEKQPQPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQ FT GVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSL FT GPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAG FT LQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKV FT HEMLIDQVPVTILNILLDCDVNKTPWCDCSGTAAAASAVQT" XX SQ Sequence 1105 BP; 287 A; 289 C; 286 G; 243 T; 0 other; gcacacttcc aaccggcagc taaaaagttt ataatatttt ccgcctatgg cccgacttcg 60 ttcaaaccac tggacttctg tataaaagcg gctccaaatg gtgaatatat ccaccataaa 120 ctgggtcttc gtctgcggcc tgtccttttg cctgggcggg attgcggtgc tcagtctcat 180 gccattggga tcagactgcg tgtgcccgct gtccaatccg ctggccaagc ttgccggtgg 240 cggagaagga gtatccgtga ttaagaaaga gccagccgat gagaagcagc cacagccaca 300 tgaccacggt gcgtccgtac acaagatggc actgctggtg ccgtttcgag accgatttga 360 ggaactcctc cagttcgtcc cccacatgac cgcctttttg aagcggcagg gcgtggcgca 420 ccacatcttt gtgctgaacc aggtggacag gttccgcttc aatcgcgcct ctctcatcaa 480 cgtgggtttc cagtttgcca gcgatgtgta cgattacatt gccatgcacg acgtagactt 540 gctgcccttg aatgacaatc tgctctatga gtatcccagc agcttgggac cactgcacat 600 cgccggaccg aagctacatc ccaaatacca ctatgataac ttcgttggag gaatattact 660 ggtgcgacgc gagcacttta agcagatgaa cggcatgtcg aaccagtact ggggctgggg 720 attagaggac gacgagttct tcgtgcgcat ccgggatgca ggactgcagg tgacgcggcc 780 gcagaacatt aagactggca ctaatgatac attcagccat attcacaacc gctatcatcg 840 taagcgggac acccagaagt gcttcaacca gaaggagatg acccgcaagc gggaccacaa 900 gacgggcctg gacaacgtga agtacaaaat acttaaggtg catgagatgc tcattgacca 960 ggtgccggtg accatcctca acattttgct cgattgtgat gttaataaaa cgccttggtg 1020 cgactgttcc ggaacggcag cggctgcatc ggcggtacaa acctgatggg ttgtgttaaa 1080 ccaaaaaaaa aaaaaaaaaa aaaaa 1105 // ![]() |