![]() |
EBI DbfetchID BT029255; SV 1; linear; mRNA; STD; PLN; 363 BP. XX AC BT029255; XX DT 24-OCT-2006 (Rel. 89, Created) DT 24-OCT-2006 (Rel. 89, Last updated, Version 1) XX DE Arabidopsis thaliana At4g38310 mRNA, complete cds. XX KW FLI_CDNA. XX OS Arabidopsis thaliana (thale cress) OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; OC eurosids II; Brassicales; Brassicaceae; Arabidopsis. XX RN [1] RP 1-363 RA Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.; RT "Arabidopsis ORF Clones"; RL Unpublished. XX RN [2] RP 1-363 RA Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.; RT ; RL Submitted (21-OCT-2006) to the EMBL/GenBank/DDBJ databases. RL Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology RL Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey RL Pines Road, La Jolla, CA 92037, USA XX FH Key Location/Qualifiers FH FT source 1..363 FT /organism="Arabidopsis thaliana" FT /chromosome="4" FT /ecotype="Columbia" FT /mol_type="mRNA" FT /clone="U86294" FT /note="This clone is in pUNI 51" FT /db_xref="taxon:3702" FT CDS 1..363 FT /codon_start=1 FT /product="At4g38310" FT /note="unknown protein" FT /db_xref="GOA:Q9SVF4" FT /db_xref="InterPro:IPR008630" FT /db_xref="UniProtKB/TrEMBL:Q9SVF4" FT /protein_id="ABJ98587.1" FT /translation="MQLDPPEPGFYDDPDLSYSIEKSITNWDEKRHEWFKSHPSFKPGS FT ENRILMVTGSQSSPCKNPIGDHLLLLRCFKNKVDYARIHGHDIFYSNSLLHPKMNSYWA FT KLPVVKAAMLAHPFMD" XX SQ Sequence 363 BP; 106 A; 94 C; 70 G; 93 T; 0 other; atgcaattag accctcccga gcccggtttt tacgacgatc cggatctaag ctactcgatc 60 gagaaatcaa tcacaaactg ggacgagaaa cggcacgaat ggtttaaatc acacccttca 120 ttcaaacccg gttcagaaaa ccggatctta atggtaaccg gttcacaatc ctcgccgtgt 180 aaaaacccaa tcggagacca tttgttactc ctccgatgtt tcaaaaacaa agtcgattac 240 gctagaatcc atggtcacga catcttctac agcaattctc ttcttcatcc gaagatgaat 300 tcgtattggg cgaaacttcc ggtggttaaa gctgcgatgc ttgctcaccc atttatggat 360 tga 363 // ![]() |