![]() |
EBI DbfetchID BT006799; SV 1; linear; mRNA; STD; HUM; 273 BP. XX AC BT006799; XX DT 15-MAY-2003 (Rel. 75, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Homo sapiens ALL1-fused gene from chromosome 1q mRNA, complete cds. XX KW FLI_CDNA. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-273 RA Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., RA Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., RA Phelan M., Farmer A.; RT "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector"; RL Unpublished. XX RN [2] RP 1-273 RA Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., RA Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., RA Phelan M., Farmer A.; RT ; RL Submitted (13-MAY-2003) to the EMBL/GenBank/DDBJ databases. RL BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA XX DR H-InvDB; HIT000099719. XX CC This CDS clone is a part of a collection of human full length CC expression clones generated by BD Biosciences Clontech and the CC Harvard Institute of Proteomics. Each CDS has been cloned in two CC forms: with and without stop-codon (to allow fusion with C-terminal CC tag). The CDS has been directionally cloned using BD In-Fusion(TM) CC cloning system between the SalI and HindIII sites of the pDNR-DUAL CC vector. Additional sequences in the clone: 'ACC' after SalI site CC and before 'ATG' to provide Kozak consensus sequence; 'GG' after CC last codon and before HindIII site to maintain reading frame. CC Clone distribution: http://bioinfo.clontech.com/orfclones. XX FH Key Location/Qualifiers FH FT source 1..273 FT /organism="Homo sapiens" FT /lab_host="DH5alpha T1 resistant" FT /mol_type="mRNA" FT /clone_lib="BD Creator(TM) CDS Library derived from MGC FT collection" FT /clone="GH00522X1.0" FT /note="Vector: pDNR-Dual" FT /db_xref="taxon:9606" FT CDS 1..273 FT /codon_start=1 FT /product="ALL1-fused gene from chromosome 1q" FT /db_xref="GOA:Q13015" FT /db_xref="HGNC:16997" FT /db_xref="UniProtKB/Swiss-Prot:Q13015" FT /protein_id="AAP35445.1" FT /translation="MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSV FT GKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL" XX SQ Sequence 273 BP; 70 A; 74 C; 71 G; 58 T; 0 other; atgagggacc ctgtgagtag ccagtacagt tcctttcttt tctggaggat gcccatccca 60 gaactggatc tgtcggagct ggaaggcctg ggtctgtcag atacagccac ctacaaggtc 120 aaagacagca gcgttggcaa aatgatcggg caagcaactg cagcagacca ggagaaaaac 180 cctgaaggtg atggcctcct tgagtacagc accttcaact tctggagagc tcccattgcc 240 agcatccact ccttcgaact ggacttgctc tag 273 // ![]() |