spacer
spacer

EBI Dbfetch

ID   BC167315; SV 1; linear; mRNA; STD; VRT; 870 BP.
XX
AC   BC167315;
XX
DT   06-JUN-2008 (Rel. 96, Created)
DT   18-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Xenopus tropicalis hypothetical protein LOC100170458, mRNA (cDNA clone
DE   MGC:135320 IMAGE:7541977), complete cds.
XX
KW   MGC.
XX
OS   Xenopus (Silurana) tropicalis (western clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Xenopus;
OC   Silurana.
XX
RN   [1]
RP   1-870
RX   DOI; 10.1002/dvdy.10174
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-870
RX   DOI; 10.1073/pnas.242603899
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-870
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (04-JUN-2008) to the EMBL/GenBank/DDBJ databases.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Richard M. Harland Laboratory, University of
CC   California, Berkeley
CC   cDNA Library Preparation: Richard M. Harland Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 329 Row: m Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..870
FT                   /organism="Xenopus (Silurana) tropicalis"
FT                   /lab_host="E. coli XL1-Blue derivative, Stratagene
FT                   ElectroTen-Blue"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_tropGas7"
FT                   /clone="MGC:135320 IMAGE:7541977"
FT                   /tissue_type="Whole embryo, Gastrula (st. 10.5-12.5)"
FT                   /note="Vector: pCS108"
FT                   /db_xref="taxon:8364"
FT   gene            1..870
FT                   /gene="LOC100170458"
FT   CDS             30..569
FT                   /codon_start=1
FT                   /gene="LOC100170458"
FT                   /product="LOC100170458 protein"
FT                   /db_xref="GOA:B3DL53"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3DL53"
FT                   /protein_id="AAI67315.1"
FT                   /translation="MSSFRWVRPLQLTLALIKPDAVANPVISEAVHQKILENNFLIIRH
FT                   KELHWRSTDSQRFYCEHKGRFFYQRLVEFMSSGPMQAYILAHEDAVQLWRNLMGPTKVF
FT                   RARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREITFFFPEFNTSDWYEKQEPRYRTG
FT                   PVFYDEERSEHRLEGE"
XX
SQ   Sequence 870 BP; 274 A; 163 C; 191 G; 242 T; 0 other;
     attcagcgga tgtgatcctt tgtgcaacca tgtcatcatt tcgctgggtt cgaccccttc        60
     agctcacgtt agcgttgatt aaacctgatg ctgtagccaa tccagtcatt tctgaggcgg       120
     tacatcaaaa gattttagaa aataactttc tgatcataag acataaagag cttcattgga       180
     gatccacaga ttctcagagg ttttattgtg agcacaaggg acgatttttc tatcaacgac       240
     tagttgagtt tatgtcaagt ggacccatgc aggcatatat tctggcacat gaggatgctg       300
     tccagttatg gaggaactta atgggtccaa ccaaagtgtt cagagcacga attgtggctc       360
     ctgggactgt gcggggagat ctgggactaa ctgacacccg taataccaca catggttctg       420
     attctgttga atcagcttgc cgtgaaatca catttttttt ccctgagttc aacactagcg       480
     attggtatga gaagcaagaa cctcgctaca gaacagggcc agtgttctat gatgaagaac       540
     ggtcagaaca ccgacttgaa ggggagtgaa gggacctaaa aggcaaactg tgtgtttatg       600
     tctgcagctt catgtcacat aaaagactat gggttttaac atgaagaagg ctgtgtatct       660
     acaccagaca aaattaggaa gtggttactg ctgtacacat ttttgctgca gcaagggaca       720
     atgggcacta tattattgtt atggaagatt ttaaatttga cgtcattctc tcagctcagt       780
     gtggcgctga ctactctgtt ttagctcaat acaaaacatt ttaataaaat aaatatacta       840
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                                        870
//


  
spacer
spacer