 |
|
EBI DbfetchID BC031045; SV 1; linear; mRNA; STD; HUM; 1412 BP. XX AC BC031045; XX DT 14-JUN-2002 (Rel. 72, Created) DT 15-OCT-2008 (Rel. 97, Last updated, Version 7) XX DE Homo sapiens B-cell translocation gene 4, mRNA (cDNA clone MGC:33003 DE IMAGE:5271706), complete cds. XX KW MGC. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-1412 RX DOI; 10.1073/pnas.242603899 RX PUBMED; 12477932. RG Mammalian Gene Collection Program Team RA Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D., RA Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F., RA Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H., RA Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K., RA Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F., RA Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S., RA Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J., RA Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J., RA Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M., RA Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X., RA Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S., RA Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G., RA Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C., RA Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I., RA Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.; RT "Generation and initial analysis of more than 15,000 full-length human and RT mouse cDNA sequences"; RL Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002). XX RN [2] RC NIH-MGC Project URL: http://mgc.nci.nih.gov RP 1-1412 RG NIH MGC Project RA ; RT ; RL Submitted (03-JUN-2002) to the EMBL/GenBank/DDBJ databases. RL National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, RL MD 20892-2590, USA XX DR ASTD; TRAN00000078498. DR Ensembl-Gn; ENSG00000137707; Homo_sapiens. DR Ensembl-Tr; ENST00000456861; Homo_sapiens. DR H-InvDB; HIT000041216. DR ImaGenes; IMAGp998L1111685Q. DR ImaGenes; IOH22515. DR ImaGenes; IRAKp961C0848Q. DR ImaGenes; IRATp970F1132D. XX CC Contact: MGC help desk CC Email: cgapbs-r@mail.nih.gov CC Tissue Procurement: Miklos Palkovits, M.D., Ph.D. CC cDNA Library Preparation: Michael J. Brownstein (NHGRI) & Shiraki CC Toshiyuki and Piero Carninci (RIKEN) CC cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) CC DNA Sequencing by: Sequencing Group at the Stanford Human Genome CC Center, Stanford University School of Medicine, Stanford, CA 94305 CC Web site: http://www-shgc.stanford.edu CC Contact: (Dickson, Mark) mcd@paxil.stanford.edu CC Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, CC R. M. CC Clone distribution: MGC clone distribution information can be found CC through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov CC Series: IRAK Plate: 48 Row: c Column: 8 CC This clone was selected for full length sequencing because it CC passed the following selection criteria: matched mRNA gi: 28872723. CC Differences found between this sequence and the human reference CC genome (build 35) are described in misc_difference features below CC and these differences were also compared to chimpanzee genomic CC seqeunces available as of 09/15/2004 00:00:00. XX FH Key Location/Qualifiers FH FT source 1..1412 FT /organism="Homo sapiens" FT /lab_host="DH10B" FT /mol_type="mRNA" FT /clone_lib="NIH_MGC_97" FT /clone="MGC:33003 IMAGE:5271706" FT /tissue_type="Testis" FT /note="Vector: pBluescriptR" FT /db_xref="taxon:9606" FT gene 1..1412 FT /gene="BTG4" FT /note="synonyms: PC3B, MGC33003" FT misc_difference 1 FT /gene="BTG4" FT /note="1 base at the 5' end does not align to the human FT genome." FT CDS 187..807 FT /codon_start=1 FT /gene="BTG4" FT /product="BTG4 protein" FT /db_xref="InterPro:IPR002087" FT /db_xref="UniProtKB/TrEMBL:Q8NEH7" FT /protein_id="AAH31045.1" FT /translation="MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSH FT WHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCR FT YGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVS FT NPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL" FT misc_difference 585 FT /gene="BTG4" FT /note="'A' in cDNA is 'C' in the human genome; no amino FT acid change. The chimpanzee genome agrees with the cDNA FT sequence, suggesting that this difference is unlikely to be FT due to an artifact." FT misc_difference 1015..1016 FT /gene="BTG4" FT /note="2 bases in cDNA are not found in the human genome. FT The chimpanzee genome agrees with the cDNA sequence, FT suggesting that this difference is unlikely to be due to an FT artifact." FT misc_difference 1395 FT /gene="BTG4" FT /note="'C' in cDNA is 'T' in the human genome. The FT chimpanzee genome agrees with the cDNA sequence, suggesting FT that this difference is unlikely to be due to an artifact." FT misc_difference 1398..1412 FT /gene="BTG4" FT /note="polyA tail: 15 bases do not align to the human FT genome." XX SQ Sequence 1412 BP; 463 A; 272 C; 240 G; 437 T; 0 other; tagggagacg cctagaagat ggaggcccag attcttgaga cgtttctctt tctgatctag 60 caggagggac aaagagctcc tccactccct cattccccaa gaaggccccc agcctaccca 120 gtttccgtga ccattccgcc ctgggaaagc ggcttcccag acctccttat ctatttttct 180 tgaatcatga gagatgaaat tgcaacaaca gttttctttg tcacaagatt ggtgaaaaaa 240 catgataaac taagtaaaca gcaaatagaa gactttgcag aaaagctgat gacgatcttg 300 tttgaaacat acagaagtca ctggcactct gattgccctt ctaaagggca agccttcagg 360 tgcatcagga taaacaacaa tcagaataaa gatcccattc tagaaagggc atgtgtggaa 420 agtaatgtag atttttctca cctgggactt ccgaaggaga tgaccatatg ggtagatccc 480 tttgaagtat gctgtaggta tggtgagaaa aaccatccat ttacagttgc ttcttttaaa 540 ggcagatggg aggaatggga actatatcaa caaatcagtt atgcagttag tagagcctca 600 tcagacgttt cctctggcac ttcctgcgat gaagaaagtt gtagcaagga acctcgtgtc 660 attcctaaag tcagcaatcc gaagagtatt tatcaggtca agagtgttcc agttcttttc 720 tatacttttt ttctatctaa ttctaaaaag aatgcactca ttatgaaaac aaagaagcaa 780 aaaaacatgg aaagaacaaa actgtagatt tttaaaagcc agactcttaa tattttggca 840 aaactttttc tgtctccttc actgcacaat gtattcccta cacttggctg agcttttagg 900 atccacataa tcttttattg tcctatttct tcatacagta tttgaagata cacaggtttc 960 cttccactta aattcctaca gaatcaaaga ttaagattag tgggattttt ttttttctgt 1020 caattgaaaa taccacggca tttatagaaa atttggatat aggaaaggtc aaaggcctat 1080 aaattctgcc actagagcag tttttctcag ctattttttt cttcttttta aaccataacc 1140 cattcaaaat atgtatattt acatttaaaa agtttcatga aacagtgctt atctttacta 1200 ggagcaatgc tcccaatgct cccaatactt ccaattaaat tcatttgatt tcaagtatct 1260 aaattgattt catgacccac aatttgaaaa acactgatct agagagaatt tgttaacact 1320 atatgtatat atttgtttgt atgttctctt aatcacctat gtattaaatg ttaaagcaat 1380 taaaatttta atatccaaaa aaaaaaaaaa aa 1412 // |
|