spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY693349; SV 1; linear; genomic DNA; STD; FUN; 312 BP.
XX
AC   AY693349;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   11-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae clone FLH114669.01X YBL073W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-312
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [2]
RP   1-312
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861G04122D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..312
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH114669.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>312
FT                   /product="YBL073W"
FT   CDS             1..312
FT                   /codon_start=1
FT                   /product="YBL073W"
FT                   /db_xref="SGD:S000000169"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38184"
FT                   /protein_id="AAT93368.1"
FT                   /translation="MLKMNDMNVSNGDVLDSVKWLILLDIKGILIDPYSYLNRSRCKWY
FT                   SIHCRLPIFYFLAPCPSDKEDLWCPFISLNPKPLKYSCSCVAIFSAFKMCPFFISWFL"
XX
SQ   Sequence 312 BP; 78 A; 65 C; 61 G; 108 T; 0 other;
     atgctgaaaa tgaatgacat gaacgtgtcc aatggggatg tccttgattc cgtgaaatgg        60
     ctgattctcc ttgacattaa aggaatactg atcgatccct atagttacct caatcggagc       120
     agatgtaaat ggtacagtat tcattgcagg cttccgatat tttatttttt agccccatgt       180
     cccagcgata aggaggatct ttggtgtcca ttcatctcat taaaccctaa accattgaaa       240
     tattcgtgtt cgtgcgtcgc gattttttcc gctttcaaga tgtgtccttt cttcatctct       300
     tggttcttat aa                                                           312
//
spacer
spacer