spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY693328; SV 1; linear; genomic DNA; STD; FUN; 348 BP.
XX
AC   AY693328;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   11-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae clone FLH115044.01X YNL303W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-348
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [2]
RP   1-348
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861H03121D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..348
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH115044.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>348
FT                   /product="YNL303W"
FT   CDS             1..348
FT                   /codon_start=1
FT                   /product="YNL303W"
FT                   /db_xref="SGD:S000005247"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53827"
FT                   /protein_id="AAT93347.1"
FT                   /translation="MTTLQIINQFVAFSLRQIIQQDSQAAIVQYANVIICTNIDALYNP
FT                   TIYIIVKLFTTTYSSMVFLMFCRGKLKSCHFYSDRNPWFDTFYLKKTKSIYFGFGYIDD
FT                   DECTYKMAKFK"
XX
SQ   Sequence 348 BP; 123 A; 54 C; 46 G; 125 T; 0 other;
     atgacgacat tgcaaataat caatcaattt gttgcgttta gtcttcgaca aattatacaa        60
     caagattcgc aggcagccat tgtccaatac gccaatgtca ttatatgtac caatatagac       120
     gcattataca atcctacaat ttatatcatt gtaaaattat ttactaccac ttattcttca       180
     atggtgtttt taatgttttg tagaggaaaa cttaaaagtt gtcattttta ttcagatcgc       240
     aatccatggt ttgacacatt ctatcttaaa aaaacaaaat ctatttattt tggtttcggc       300
     tatattgatg atgatgaatg tacatataaa atggcaaaat ttaaataa                    348
//
spacer
spacer