spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY693311; SV 1; linear; genomic DNA; STD; FUN; 384 BP.
XX
AC   AY693311;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   11-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae clone FLH114395.01X YKL169C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-384
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [2]
RP   1-384
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861C03122D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..384
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH114395.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>384
FT                   /product="YKL169C"
FT   CDS             1..384
FT                   /codon_start=1
FT                   /product="YKL169C"
FT                   /db_xref="SGD:S000001652"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36050"
FT                   /protein_id="AAT93330.1"
FT                   /translation="MGVLLFLYDPTCQRAYLIVSLVFQCSIYTTIISHNSCPQRFTGIF
FT                   INQNASSISECNGGAILSAHVTLFRPYDNCVTNITFFDTVGVGCPRNVLSQGLCFLYNT
FT                   DYSVSNHCRTLGGPFPYYFNTFC"
XX
SQ   Sequence 384 BP; 91 A; 91 C; 68 G; 134 T; 0 other;
     atgggggtac ttttattctt atatgaccct acttgccaaa gagcatatct tattgtatcc        60
     cttgtctttc agtgttctat ctacacaacc atcattagcc ataattcttg tccccagagg       120
     ttcaccggta tttttattaa tcaaaacgca agcagtatct ccgaatgcaa cggtggagcc       180
     atcctttctg cacatgttac gctgtttaga ccttacgaca attgcgtgac aaatatcacc       240
     ttttttgaca cggttggtgt tggctgtccc cgtaatgttt tgagtcaagg gctttgcttt       300
     ctgtataaca cagactattc tgtctccaac cattgcagga ctcttggggg accctttcct       360
     tattacttta atacattctg ctaa                                              384
//
spacer
spacer