spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY693291; SV 1; linear; genomic DNA; STD; FUN; 387 BP.
XX
AC   AY693291;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   11-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae clone FLH115101.01X YML090W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-387
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [2]
RP   1-387
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861D06121D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..387
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH115101.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>387
FT                   /product="YML090W"
FT   CDS             1..387
FT                   /codon_start=1
FT                   /product="YML090W"
FT                   /db_xref="GOA:Q04501"
FT                   /db_xref="SGD:S000004555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04501"
FT                   /protein_id="AAT93310.1"
FT                   /translation="MLVFSFLFVVVSINLNALIFLCKKSWASYLFLYLYNFFFCEDEYK
FT                   LTKNCVRVEAIAPFMMCLGSLGAILGKQRTANFLLLSYNVINNPVVLVYYVENFSRINF
FT                   IKHTTKEKSVIWTNERQLNPWICN"
XX
SQ   Sequence 387 BP; 116 A; 49 C; 69 G; 153 T; 0 other;
     atgcttgttt tttcttttct gtttgttgta gtctctataa atttaaatgc acttatcttt        60
     ttatgcaaaa aaagctgggc gagttatttg tttctatatt tgtataattt ttttttttgt       120
     gaagatgaat ataaactgac aaaaaattgt gtcagagttg aagctatagc tccttttatg       180
     atgtgtcttg gttctttggg tgcgatatta gggaaacaac gcacagcaaa ttttcttctg       240
     ctttcttata acgttataaa caatcctgtt gtcttggttt attatgtgga aaacttttca       300
     cggatcaatt ttataaagca tacaactaaa gagaaaagtg taatatggac gaacgagaga       360
     caacttaatc catggatttg taattga                                           387
//
spacer
spacer