spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY693253; SV 1; linear; genomic DNA; STD; FUN; 342 BP.
XX
AC   AY693253;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   11-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Saccharomyces cerevisiae clone FLH158447.01X YGL217C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-342
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [2]
RP   1-342
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861E01129D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..342
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH158447.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>342
FT                   /product="YGL217C"
FT   CDS             1..342
FT                   /codon_start=1
FT                   /product="YGL217C"
FT                   /db_xref="SGD:S000003185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53085"
FT                   /protein_id="AAT93272.1"
FT                   /translation="MSILSSTQSTILRIPSGLITFLLSKLFLLLRVEPSSASMSISESE
FT                   LLLMGNINDESPKPGKLASAPLASLTNLVFSIDVKGLTLIATTMEDCLVSGTFMLVSIV
FT                   YSWKENSSS"
XX
SQ   Sequence 342 BP; 91 A; 80 C; 60 G; 111 T; 0 other;
     atgagcattc tatcatccac acaatccaca attttacgta taccctccgg tctaattact        60
     tttctcctca gcaagctatt tcttttgctc cgcgtagaac cttcttcagc gtctatgtct       120
     atatcggagt cggagttatt actcatgggt aatattaacg acgaatcccc caaaccggga       180
     aagttagctt ctgcaccact agcttcattg accaatcttg ttttttccat tgacgtaaag       240
     ggccttactc ttatagctac gactatggag gattgtcttg tttcaggcac gttcatgtta       300
     gtgtcaatag tatacagctg gaaagaaaac tcaagtagtt aa                          342
//
spacer
spacer