spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   AY692611; SV 1; linear; genomic DNA; STD; FUN; 417 BP.
XX
AC   AY692611;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH113659.01X YBL049W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-417
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-417
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-417
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861F05123D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..417
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH113659.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>417
FT                   /product="YBL049W"
FT   CDS             1..417
FT                   /codon_start=1
FT                   /product="YBL049W"
FT                   /db_xref="GOA:P38191"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="SGD:S000000145"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38191"
FT                   /protein_id="AAT92630.1"
FT                   /translation="MGLRYSIYIENPLSSPSSSYKSINDPLFHSQHRSQKNVSFITYGC
FT                   RHCKTHLSSSFQIISRDYRGRTGTAYLMNKVVNVVEGKVEQRRMLTGDYLVCDILCHWC
FT                   KRNVGWKYLQSSNDDQQYKEGKFILELKNICKCT"
XX
SQ   Sequence 417 BP; 132 A; 75 C; 88 G; 122 T; 0 other;
     atgggattgc gttactccat atatattgaa aatccgttat cttccccatc atcatcgtat        60
     aaatcaataa acgacccgtt attccactct cagcatcgat cgcaaaaaaa cgtgagcttc       120
     atcacctacg gttgtagaca ttgcaagaca catctttcca gttccttcca gattatttct       180
     agagattata ggggtaggac cggaactgct tatttaatga acaaagttgt taatgtcgtt       240
     gaaggaaagg tcgagcaacg aagaatgttg actggcgact acttagtctg tgatattctt       300
     tgtcattggt gcaagaggaa cgtaggttgg aaatacttgc agagcagcaa tgatgatcag       360
     cagtataagg aaggaaagtt tatcttagag ctgaaaaaca tttgtaaatg tacttga          417
//
spacer
spacer