EBI Dbfetch

ID   AY692604; SV 1; linear; genomic DNA; STD; FUN; 363 BP.
XX
AC   AY692604;
XX
DT   11-AUG-2004 (Rel. 80, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 3)
XX
DE   Saccharomyces cerevisiae clone FLH115325.01X YAL068C gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-363
RX   DOI; 10.1101/gr.6037607
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-363
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-363
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (20-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles st., Cambridge, MA 02141, USA
XX
DR   ImaGenes; RZPDe861E11121D.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway  cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..363
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH115325.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>363
FT                   /product="YAL068C"
FT   CDS             1..363
FT                   /codon_start=1
FT                   /product="YAL068C"
FT                   /db_xref="GOA:P38725"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="SGD:S000000505"
FT                   /db_xref="SGD:S000000775"
FT                   /db_xref="SGD:S000001038"
FT                   /db_xref="SGD:S000001438"
FT                   /db_xref="SGD:S000001874"
FT                   /db_xref="SGD:S000002142"
FT                   /db_xref="SGD:S000002950"
FT                   /db_xref="SGD:S000003230"
FT                   /db_xref="SGD:S000003526"
FT                   /db_xref="SGD:S000003759"
FT                   /db_xref="SGD:S000003987"
FT                   /db_xref="SGD:S000004453"
FT                   /db_xref="SGD:S000005359"
FT                   /db_xref="SGD:S000005521"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38725"
FT                   /protein_id="AAT92623.1"
FT                   /translation="MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRA
FT                   HLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKP
FT                   AISSALSKDGIYTITN"
FT   variation       10
FT                   /replace="t"
FT                   /note="compared to SGD sequence"
FT   variation       355
FT                   /replace="g"
FT                   /note="compared to SGD sequence"
XX
SQ   Sequence 363 BP; 95 A; 109 C; 71 G; 88 T; 0 other;
     atggtcaaac taacttcaat cgccgctggt gtcgctgcca tcgctgctac tgcttctgca        60
     accaccactc tagctcaatc tgacgaaaga gtcaacttgg tggaattggg tgtctacgtc       120
     tctgatatca gagctcactt agcccaatac tacatgttcc aagccgccca cccaactgaa       180
     acctacccag tcgaagttgc tgaagccgtt ttcaactacg gtgacttcac caccatgttg       240
     accggtattg ctccagacca agtgaccaga atgatcaccg gtgttccatg gtactccagc       300
     agattaaagc cagccatctc cagtgctcta tccaaggacg gtatctacac tatcacaaac       360
     tag                                                                     363
//